CAZyme Information: MGYG000002511_00360

Basic Information

• Species: Klebsiella variicola
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Klebsiella; Klebsiella variicola
• CAZyme ID: MGYG000002511_00360
• CAZy Family: GT94
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
319	MGYG000002511_1|CGC6	36524.51	9.932

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002511	5624300	Isolate	Australia	Oceania

• Gene Location: Start: 394844; End: 395803 Strand: -

Full Sequence      

MKKIGYFPPPSEKNSYTIRMSDLLGQFGDVTPISPKKWKNAFFGIKKYDVIVFNWLENRC
FGKNGKFKFSSFIISMLWFSIMKHSARKIIYVRHNIYPHNILDKNKKLSVKIMNYFERKS
SYTVVHSKSACTGGRVYIPHPLYELKSFSPVSVIEDEKYFVCFGRIEKYKKLDELIKNWP
LDHKLIIVGSSDDKDYCLHLKKLATGKKIEIIDKFISDEDAYNLVSRAEYSILPSDSKSM
IVSGSFFFSISAGTPVIAVKSDFYKSLSVYNGELNLVNGIGDIGAALQNLPNKQKIMSTE
FTNQFSDDAIINSLKVIIK

Enzyme Prediction     

No EC number prediction in MGYG000002511_00360.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT94	47	267	7.6e-17	0.7915194346289752

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd03822	GT4_mannosyltransferase-like	4.82e-11	46	308	74	355	mannosyltransferases of glycosyltransferase family 4 and similar proteins. This family is most closely related to the GT1 family of glycosyltransferases. ORF704 in E. coli has been shown to be involved in the biosynthesis of O-specific mannose homopolysaccharides.
COG0438	RfaB	1.14e-08	1	319	3	375	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].
pfam00534	Glycos_transf_1	1.22e-08	156	267	1	116	Glycosyl transferases group 1. Mutations in this domain of PIGA lead to disease (Paroxysmal Nocturnal haemoglobinuria). Members of this family transfer activated sugars to a variety of substrates, including glycogen, Fructose-6-phosphate and lipopolysaccharides. Members of this family transfer UDP, ADP, GDP or CMP linked sugars. The eukaryotic glycogen synthases may be distant members of this family.
cd03809	GT4_MtfB-like	7.27e-08	77	258	130	298	glycosyltransferases MtfB, WbpX, and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases. MtfB (mannosyltransferase B) in E. coli has been shown to direct the growth of the O9-specific polysaccharide chain. It transfers two mannoses into the position 3 of the previously synthesized polysaccharide.
cd03794	GT4_WbuB-like	1.54e-07	38	284	89	341	Escherichia coli WbuB and similar proteins. This family is most closely related to the GT1 family of glycosyltransferases. WbuB in E. coli is involved in the biosynthesis of the O26 O-antigen. It has been proposed to function as an N-acetyl-L-fucosamine (L-FucNAc) transferase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CZQ24750.1	6.79e-222	1	319	1	319
QSA40311.1	3.40e-42	2	318	3	333
QTL45769.1	3.40e-42	2	318	3	333
QSA56198.1	3.40e-42	2	318	3	333
QSA71674.1	3.40e-42	2	318	3	333

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000055	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002511_00360.