CAZyme Information: MGYG000002512_01697

Basic Information

• Species: Morganella morganii
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Morganella; Morganella morganii
• CAZyme ID: MGYG000002512_01697
• CAZy Family: GH23
• CAZyme Description: Endo-type membrane-bound lytic murein transglycosylase A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
226	MGYG000002512_1|CGC15	24604.8	9.526

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002512	3906921	Isolate	not provided	not provided

• Gene Location: Start: 1733958; End: 1734638 Strand: +

Full Sequence      

MKKTVSVIALALLLAGCSGSSKQSRTGSGGWITAPSSGIGDYSAYPVKGSGVYPATPFDQ
FIRQASNRYEVDETLIRAIIEVESSYRPDVISKSNAVGLMQIKASTAGRDAYRVKGRNGE
PSTRELLDPQTNIDIGTTYIRIIRDQHLAGITDPQTLNYATIVSYVNGAGALLRTFDNNR
ALAIEKINALSADEFYEHVQSKHPASQAPRYLWKVKNAYRALAMAD

Enzyme Prediction     

No EC number prediction in MGYG000002512_01697.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	71	222	6.5e-20	0.8148148148148148

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd16893	LT_MltC_MltE	3.62e-81	61	220	2	162	membrane-bound lytic murein transglycosylases MltC and MltE, and similar proteins. MltC and MltE are periplasmic, outer membrane attached lytic transglycosylases (LTs), which cleave beta-1,4-glycosidic bonds joining N-acetylmuramic acid and N-acetylglucosamine in the cell wall peptidoglycan, yielding 1,6-anhydromuropeptides. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda
PRK15470	emtA	2.22e-71	10	222	9	203	membrane-bound lytic murein transglycosylase EmtA.
PRK11671	mltC	6.40e-61	61	220	195	357	membrane-bound lytic murein transglycosylase MltC.
pfam01464	SLT	2.32e-29	62	187	1	114	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.
COG0741	MltE	1.04e-27	43	220	124	296	Soluble lytic murein transglycosylase and related regulatory proteins (some contain LysM/invasin domains) [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QWM09181.1	1.83e-159	1	226	1	226
AMG70295.1	1.83e-159	1	226	1	226
QWM02105.1	1.83e-159	1	226	1	226
QUI29040.1	1.83e-159	1	226	1	226
AGG31495.1	1.83e-159	1	226	1	226

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2Y8P_A	4.95e-57	63	222	27	186	CrystalStructure of an Outer Membrane-Anchored Endolytic Peptidoglycan Lytic Transglycosylase (MltE) from Escherichia coli [Escherichia coli K-12],2Y8P_B Crystal Structure of an Outer Membrane-Anchored Endolytic Peptidoglycan Lytic Transglycosylase (MltE) from Escherichia coli [Escherichia coli K-12]
3T36_A	6.55e-57	63	222	44	203	Crystalstructure of lytic transglycosylase MltE from Eschericha coli [Escherichia coli K-12],3T36_B Crystal structure of lytic transglycosylase MltE from Eschericha coli [Escherichia coli K-12],3T36_C Crystal structure of lytic transglycosylase MltE from Eschericha coli [Escherichia coli K-12],3T36_D Crystal structure of lytic transglycosylase MltE from Eschericha coli [Escherichia coli K-12],3T36_E Crystal structure of lytic transglycosylase MltE from Eschericha coli [Escherichia coli K-12],4HJV_A Crystal structure of E. coli MltE with bound bulgecin and murodipeptide [Escherichia coli K-12],4HJV_B Crystal structure of E. coli MltE with bound bulgecin and murodipeptide [Escherichia coli K-12],4HJV_C Crystal structure of E. coli MltE with bound bulgecin and murodipeptide [Escherichia coli K-12],4HJV_D Crystal structure of E. coli MltE with bound bulgecin and murodipeptide [Escherichia coli K-12],4HJV_E Crystal structure of E. coli MltE with bound bulgecin and murodipeptide [Escherichia coli K-12]
6GHY_A	1.41e-56	63	222	27	186	Structureof Lytic Transglycosylase MltE inactive mutant E64Q from E.coli [Escherichia coli K-12],6GHY_B Structure of Lytic Transglycosylase MltE inactive mutant E64Q from E.coli [Escherichia coli K-12]
6GI3_B	1.41e-56	63	222	27	186	Structureof Lytic Transglycosylase MltE mutant S73A from E.coli [Escherichia coli]
6GI4_B	1.41e-56	63	222	27	186	Structureof Lytic Transglycosylase MltE mutant S75A from E.coli [Escherichia coli]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A8AFS5	2.96e-60	10	222	9	203	Endo-type membrane-bound lytic murein transglycosylase A OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) OX=290338 GN=emtA PE=3 SV=1
A7MKC3	2.39e-59	64	222	45	203	Endo-type membrane-bound lytic murein transglycosylase A OS=Cronobacter sakazakii (strain ATCC BAA-894) OX=290339 GN=emtA PE=3 SV=2
B5R901	6.80e-59	64	222	45	203	Endo-type membrane-bound lytic murein transglycosylase A OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) OX=550538 GN=emtA PE=3 SV=1
B7LSJ1	6.80e-59	63	218	44	199	Endo-type membrane-bound lytic murein transglycosylase A OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73) OX=585054 GN=emtA PE=3 SV=1
B5R2X1	6.80e-59	64	222	45	203	Endo-type membrane-bound lytic murein transglycosylase A OS=Salmonella enteritidis PT4 (strain P125109) OX=550537 GN=emtA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000000	1.000050	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002512_01697.