CAZyme Information: MGYG000002512_03459

Basic Information

• Species: Morganella morganii
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Morganella; Morganella morganii
• CAZyme ID: MGYG000002512_03459
• CAZy Family: GH3
• CAZyme Description: Beta-hexosaminidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
625	MGYG000002512_1|CGC33	69613.82	6.9477

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002512	3906921	Isolate	not provided	not provided

• Gene Location: Start: 3585245; End: 3587122 Strand: +

Full Sequence      

MKKVLLLFILFSFQIIAAPLTPSDIDALKKEPERAAENIVASMSQTEKIGQLMMLDFRYW
DIFRSPVPVPVININNDIKDIIYRYRLGGIVLFRENLINTPQTVKLINDIQSSRYRLPLF
ISTDQEGGYITRLRVGTEMPGNMALGATRDPDSARLTGEIHGSELSALGFNMNFGPVVDI
NNNQNNPVIGVRAYSDRKELTEILSAAYIRGIHQYGLITALKHFPGHGNVSADSHVALPV
VTSDEKTWRQTELPPFIYALQHGADAVMTAHIIVPALDDTKIKTRDGSEAGTPATLSKPI
LTGILRKELHFQGLIITDAMDMKAITDNFDLNFAVEHALSAGADIILMPVKMWDEEAVKR
LDNLYRYLDEQAQKNPELQQRIDESAKRVVLMKLNKAISGAPADPVKAQQIVASVQHKNQ
ENKVSEQAVTIITNDGILPYQLKPENKILVISDEYPRNQLIKKHLNDIARETETRIHVTA
QKIKTDKKTLSEKKISTMISGQDIILLVTYNLRERDTNAQFIINSANDAGIPLVVISSRD
PYDIASLSNVKANIAIYGIIGFDITNGQRNALETNIRSGLRTLFSGKNARPLNYPAGRLP
ADIKDPESGIILYPYGTGETYDKQD

Enzyme Prediction     

No EC number prediction in MGYG000002512_03459.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	111	348	3.4e-62	0.9861111111111112

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1472	BglX	5.03e-100	43	473	1	392	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
pfam00933	Glyco_hydro_3	7.48e-90	47	389	4	313	Glycosyl hydrolase family 3 N terminal domain.
PRK05337	PRK05337	7.82e-55	88	388	27	308	beta-hexosaminidase; Provisional
PRK15098	PRK15098	1.06e-18	1	393	1	353	beta-glucosidase BglX.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QCY22618.1	0.0	1	625	1	625
QIC13698.1	0.0	1	625	1	625
SQL29977.1	0.0	1	625	1	625
AMG71999.1	0.0	1	625	1	625
AGG29823.1	0.0	1	625	1	625

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3BMX_A	2.83e-125	36	618	35	633	Beta-N-hexosaminidase(YbbD) from Bacillus subtilis [Bacillus subtilis],3BMX_B Beta-N-hexosaminidase (YbbD) from Bacillus subtilis [Bacillus subtilis],3NVD_A Structure of YBBD in complex with pugnac [Bacillus subtilis],3NVD_B Structure of YBBD in complex with pugnac [Bacillus subtilis]
3LK6_A	7.45e-125	36	618	9	607	ChainA, Lipoprotein ybbD [Bacillus subtilis],3LK6_B Chain B, Lipoprotein ybbD [Bacillus subtilis],3LK6_C Chain C, Lipoprotein ybbD [Bacillus subtilis],3LK6_D Chain D, Lipoprotein ybbD [Bacillus subtilis]
4GYJ_A	1.87e-124	36	618	39	637	Crystalstructure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1) [Bacillus subtilis subsp. subtilis str. 168],4GYJ_B Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1) [Bacillus subtilis subsp. subtilis str. 168],4GYK_A Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1211) [Bacillus subtilis subsp. subtilis str. 168],4GYK_B Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1211) [Bacillus subtilis subsp. subtilis str. 168]
6K5J_A	8.52e-78	42	557	10	503	Structureof a glycoside hydrolase family 3 beta-N-acetylglucosaminidase from Paenibacillus sp. str. FPU-7 [Paenibacillaceae]
3SQL_A	2.28e-49	87	349	58	311	CrystalStructure of Glycoside Hydrolase from Synechococcus [Synechococcus sp. PCC 7002],3SQL_B Crystal Structure of Glycoside Hydrolase from Synechococcus [Synechococcus sp. PCC 7002],3SQM_A Crystal Structure of Glycoside Hydrolase from Synechococcus Complexed with N-acetyl-D-glucosamine [Synechococcus sp. PCC 7002],3SQM_B Crystal Structure of Glycoside Hydrolase from Synechococcus Complexed with N-acetyl-D-glucosamine [Synechococcus sp. PCC 7002],3SQM_C Crystal Structure of Glycoside Hydrolase from Synechococcus Complexed with N-acetyl-D-glucosamine [Synechococcus sp. PCC 7002],3SQM_D Crystal Structure of Glycoside Hydrolase from Synechococcus Complexed with N-acetyl-D-glucosamine [Synechococcus sp. PCC 7002]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P40406	1.55e-124	36	618	35	633	Beta-hexosaminidase OS=Bacillus subtilis (strain 168) OX=224308 GN=nagZ PE=1 SV=1
P48823	2.24e-74	43	453	16	438	Beta-hexosaminidase A OS=Pseudoalteromonas piscicida OX=43662 GN=cht60 PE=1 SV=1
B4SRK3	1.16e-36	79	348	16	277	Beta-hexosaminidase OS=Stenotrophomonas maltophilia (strain R551-3) OX=391008 GN=nagZ PE=3 SV=1
B2FPW9	1.16e-36	79	348	16	277	Beta-hexosaminidase OS=Stenotrophomonas maltophilia (strain K279a) OX=522373 GN=nagZ PE=3 SV=1
B2I6G9	7.72e-36	87	348	24	277	Beta-hexosaminidase OS=Xylella fastidiosa (strain M23) OX=405441 GN=nagZ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000302	0.998996	0.000195	0.000158	0.000163	0.000159

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002512_03459.