CAZyme Information: MGYG000002513_00649

Basic Information

• Species: Morganella morganii_A
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Morganella; Morganella morganii_A
• CAZyme ID: MGYG000002513_00649
• CAZy Family: GH23
• CAZyme Description: Endo-type membrane-bound lytic murein transglycosylase A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
228	MGYG000002513_42|CGC1	24932.09	9.081

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002513	3981937	Isolate	United States	North America

• Gene Location: Start: 7795; End: 8481 Strand: -

Full Sequence      

MKKTVSVIALALLLAGCSGSSEQNRTNYGSGGWITPPSSGITDSSVYPVKGSGVYPATPF
DQFIRQASNRYEVDETLIRAIIEVESSYRPEVISKSNAVGLMQIKASTAGRDAYRVKGRN
GEPSTRDLLDPQTNIDIGTTYIRIIRDQHLAGITDPQTLNYATIVSYVNGAGALLRTFDN
NRALAIEKINALSADEFYEHVQSKHPASQAPRYLWKVKNAYRALAMAD

Enzyme Prediction     

No EC number prediction in MGYG000002513_00649.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	73	224	3e-20	0.8148148148148148

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd16893	LT_MltC_MltE	1.11e-80	63	222	2	162	membrane-bound lytic murein transglycosylases MltC and MltE, and similar proteins. MltC and MltE are periplasmic, outer membrane attached lytic transglycosylases (LTs), which cleave beta-1,4-glycosidic bonds joining N-acetylmuramic acid and N-acetylglucosamine in the cell wall peptidoglycan, yielding 1,6-anhydromuropeptides. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda
PRK15470	emtA	5.35e-72	10	224	9	203	membrane-bound lytic murein transglycosylase EmtA.
PRK11671	mltC	6.95e-61	63	222	195	357	membrane-bound lytic murein transglycosylase MltC.
pfam01464	SLT	4.43e-29	64	189	1	114	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.
COG0741	MltE	8.86e-28	44	222	123	296	Soluble lytic murein transglycosylase and related regulatory proteins (some contain LysM/invasin domains) [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QXO48503.1	9.43e-163	1	228	1	228
QXO60119.1	9.43e-163	1	228	1	228
QXO41309.1	9.43e-163	1	228	1	228
QXO56284.1	9.43e-163	1	228	1	228
QXO63990.1	9.43e-163	1	228	1	228

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2Y8P_A	2.13e-56	65	224	27	186	CrystalStructure of an Outer Membrane-Anchored Endolytic Peptidoglycan Lytic Transglycosylase (MltE) from Escherichia coli [Escherichia coli K-12],2Y8P_B Crystal Structure of an Outer Membrane-Anchored Endolytic Peptidoglycan Lytic Transglycosylase (MltE) from Escherichia coli [Escherichia coli K-12]
3T36_A	2.82e-56	65	224	44	203	Crystalstructure of lytic transglycosylase MltE from Eschericha coli [Escherichia coli K-12],3T36_B Crystal structure of lytic transglycosylase MltE from Eschericha coli [Escherichia coli K-12],3T36_C Crystal structure of lytic transglycosylase MltE from Eschericha coli [Escherichia coli K-12],3T36_D Crystal structure of lytic transglycosylase MltE from Eschericha coli [Escherichia coli K-12],3T36_E Crystal structure of lytic transglycosylase MltE from Eschericha coli [Escherichia coli K-12],4HJV_A Crystal structure of E. coli MltE with bound bulgecin and murodipeptide [Escherichia coli K-12],4HJV_B Crystal structure of E. coli MltE with bound bulgecin and murodipeptide [Escherichia coli K-12],4HJV_C Crystal structure of E. coli MltE with bound bulgecin and murodipeptide [Escherichia coli K-12],4HJV_D Crystal structure of E. coli MltE with bound bulgecin and murodipeptide [Escherichia coli K-12],4HJV_E Crystal structure of E. coli MltE with bound bulgecin and murodipeptide [Escherichia coli K-12]
6GHY_A	6.07e-56	65	224	27	186	Structureof Lytic Transglycosylase MltE inactive mutant E64Q from E.coli [Escherichia coli K-12],6GHY_B Structure of Lytic Transglycosylase MltE inactive mutant E64Q from E.coli [Escherichia coli K-12]
6GI3_B	6.07e-56	65	224	27	186	Structureof Lytic Transglycosylase MltE mutant S73A from E.coli [Escherichia coli]
6GI4_B	6.07e-56	65	224	27	186	Structureof Lytic Transglycosylase MltE mutant S75A from E.coli [Escherichia coli]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A8AFS5	5.56e-61	10	224	9	203	Endo-type membrane-bound lytic murein transglycosylase A OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) OX=290338 GN=emtA PE=3 SV=1
B5BI54	2.57e-59	10	224	9	203	Endo-type membrane-bound lytic murein transglycosylase A OS=Salmonella paratyphi A (strain AKU_12601) OX=554290 GN=emtA PE=3 SV=1
Q5PN08	2.57e-59	10	224	9	203	Endo-type membrane-bound lytic murein transglycosylase A OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) OX=295319 GN=emtA PE=3 SV=1
B5R2X1	2.57e-59	10	224	9	203	Endo-type membrane-bound lytic murein transglycosylase A OS=Salmonella enteritidis PT4 (strain P125109) OX=550537 GN=emtA PE=3 SV=1
B5R901	2.57e-59	10	224	9	203	Endo-type membrane-bound lytic murein transglycosylase A OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) OX=550538 GN=emtA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000000	1.000025	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002513_00649.