CAZyme Information: MGYG000002514_01371

Basic Information

• Species: Proteus mirabilis
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Proteus; Proteus mirabilis
• CAZyme ID: MGYG000002514_01371
• CAZy Family: GH105
• CAZyme Description: Unsaturated rhamnogalacturonyl hydrolase YteR

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
356	MGYG000002514_1|CGC10	41345.62	5.755

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002514	4101538	Isolate	Sweden	Europe

• Gene Location: Start: 1446118; End: 1447188 Strand: -

Full Sequence      

MEHANTEALQRDLVLQNMKRVYRYQSAHQVRSVRRRSGKTRFIKDTDWERGVLWTCVSAA
WQATQDKEYLNGVLNYTLHTGFRTGPNARFADDHVCAQAYLAISPLFEQSEILEPTIKAF
DIMLNDPKPGREDWWWCDALFMAPPGFAALAEIISERRYLDYMHTAYWDAIEHLRDAETG
LIFRDHRYIPDSQGNEMREANGEKVFWSRGIGWVLASIPRILQYMPDDYHERDRYITLFK
QLARSILDYQHEDGFWRTSLLDPDNFPAPESSATALFCYGLAWGINQGELNKEEYFPALH
RAWSALQSCIHDNGMIGWVQLPAFNPREVKFEHNMDYGAGAYLLAGSEVLKMTLNN

Enzyme Prediction     

No EC number prediction in MGYG000002514_01371.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	40	351	1.1e-84	0.9789156626506024

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4225	YesR	1.99e-106	17	351	7	355	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].
pfam07470	Glyco_hydro_88	5.13e-70	47	352	28	342	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AWR59095.1	8.27e-278	1	356	1	356
QKQ96649.1	3.37e-277	1	356	1	356
QIG02670.1	3.37e-277	1	356	1	356
ARA22901.1	3.37e-277	1	356	1	356
QJB74113.1	3.37e-277	1	356	1	356

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4CE7_A	1.14e-80	43	352	48	369	Crystalstructure of a novel unsaturated beta-glucuronyl hydrolase enzyme, belonging to family GH105, involved in ulvan degradation [Nonlabens ulvanivorans],4CE7_B Crystal structure of a novel unsaturated beta-glucuronyl hydrolase enzyme, belonging to family GH105, involved in ulvan degradation [Nonlabens ulvanivorans],4CE7_C Crystal structure of a novel unsaturated beta-glucuronyl hydrolase enzyme, belonging to family GH105, involved in ulvan degradation [Nonlabens ulvanivorans]
5NOA_A	2.58e-49	90	348	114	370	PolysaccharideLyase BACCELL_00875 [Bacteroides thetaiotaomicron]
4Q88_A	5.66e-44	23	348	26	353	ChainA, Uncharacterized protein [Phocaeicola vulgatus ATCC 8482],4Q88_B Chain B, Uncharacterized protein [Phocaeicola vulgatus ATCC 8482]
3K11_A	1.22e-15	181	352	234	413	Crystalstructure of Putative glycosyl hydrolase (NP_813087.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 1.80 A resolution [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
L7P9J4	7.68e-80	43	352	55	376	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Nonlabens ulvanivorans OX=906888 GN=IL45_01505 PE=1 SV=1
T2KPL9	1.70e-75	43	352	53	375	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22220 PE=2 SV=1
P9WF04	4.94e-64	91	350	136	409	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_28 PE=1 SV=1
O31521	1.86e-07	47	351	30	337	Unsaturated rhamnogalacturonyl hydrolase YesR OS=Bacillus subtilis (strain 168) OX=224308 GN=yesR PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000045	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002514_01371.