CAZyme Information: MGYG000002514_02319

Basic Information

• Species: Proteus mirabilis
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Proteus; Proteus mirabilis
• CAZyme ID: MGYG000002514_02319
• CAZy Family: GT9
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
362		42084.94	9.7968

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002514	4101538	Isolate	Sweden	Europe

• Gene Location: Start: 2479105; End: 2480193 Strand: +

Full Sequence      

MSQKRFSTIRRLNRQKNYFLKKVKFAIAKFFIDPISRKPFALKKQPKVLFLRDDDKIGDM
VVSTSILRELKNSGYNIDIVTGKSNFCVIEYSDLYNDHYTYEEKLFSIIKLALTLRKNNY
DLIIDMGELISIPYLMFIRLINARNVVGFNKNNIKSYNLNINYNEYTSHVIERYKKMLDA
LNVPFGDLKYEINIPEIVENRIVDFINNLPYKKNVVINPFSASEKRDISKEQLLFIISYL
KKYSVNIIFIGRQDDLVNLQIDSFLSNPIGDFISASAIIKHADLIITPDTSIVHVATAFD
KPTLALYGNDYHGKYVNNFMWSPNNKKAIQITQKKIDSKVSDISIDLIKSKLDFLVDKYL
CQ

Enzyme Prediction     

No EC number prediction in MGYG000002514_02319.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT9	110	312	1.5e-28	0.8222222222222222

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG0859	RfaF	8.35e-30	47	356	3	330	ADP-heptose:LPS heptosyltransferase [Cell wall/membrane/envelope biogenesis].
cd03789	GT9_LPS_heptosyltransferase	1.86e-23	47	308	1	223	lipopolysaccharide heptosyltransferase and similar proteins. Lipopolysaccharide heptosyltransferase (2.4.99.B6) is involved in the biosynthesis of lipooligosaccharide (LOS). Lipopolysaccharide (LPS) is a major component of the outer membrane of gram-negative bacteria. LPS heptosyltransferase transfers heptose molecules from ADP-heptose to 3-deoxy-D-manno-octulosonic acid (KDO), a part of the inner core component of LPS. This family also contains lipopolysaccharide 1,2-N-acetylglucosaminetransferase EC 2.4.1.56 and belongs to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.
pfam01075	Glyco_transf_9	3.42e-12	108	331	1	227	Glycosyltransferase family 9 (heptosyltransferase). Members of this family belong to glycosyltransferase family 9. Lipopolysaccharide is a major component of the outer leaflet of the outer membrane in Gram-negative bacteria. It is composed of three domains; lipid A, Core oligosaccharide and the O-antigen. All of these enzymes transfer heptose to the lipopolysaccharide core.
PRK10422	PRK10422	3.46e-11	58	331	17	306	lipopolysaccharide core biosynthesis protein; Provisional
TIGR02195	heptsyl_trn_II	0.005	275	308	245	278	lipopolysaccharide heptosyltransferase II. This family consists of examples of ADP-heptose:LPS heptosyltransferase II, an enzyme of LPS inner core region biosynthesis. LPS, composed of lipid A, a core region, and O antigen, is found in the outer membrane of Gram-negative bacteria. [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AWR59971.1	1.06e-258	1	362	1	362
ARX09404.1	1.51e-258	1	362	1	362
ASB02031.1	2.50e-257	1	362	1	362
QLJ21192.1	3.70e-215	60	362	1	303
QER01984.1	3.70e-215	60	362	1	303

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P27242	6.07e-31	13	345	7	348	Lipopolysaccharide 1,2-N-acetylglucosaminetransferase OS=Escherichia coli (strain K12) OX=83333 GN=waaU PE=4 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000058	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002514_02319.