CAZyme Information: MGYG000002515_01697

Basic Information

• Species: Escherichia fergusonii
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Escherichia; Escherichia fergusonii
• CAZyme ID: MGYG000002515_01697
• CAZy Family: GH23
• CAZyme Description: Endo-type membrane-bound lytic murein transglycosylase A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
203	MGYG000002515_1|CGC11	22385.78	10.0768

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002515	4643861	Isolate	not provided	not provided

• Gene Location: Start: 1811565; End: 1812176 Strand: -

Full Sequence      

MKLRWFAFLVVLLAGCATKRDYENPPWNAKVPVQRAMQWMPISQKAGAAWNVDPQLITAI
IAIESGGNPNAVSKSNAVGLMQLKASTSGRDVYRRMGWSGEPTTSELKNPERNISMGAAY
LNILETGPLAGIKDPQVLQYALVVSYANGAGALLRTFSSDRKKAITKINDLSADEFFDHV
AKNHPAPQAPRYIWKLQRALDEM

Enzyme Prediction     

No EC number prediction in MGYG000002515_01697.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	38	198	1.2e-16	0.8518518518518519

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK15470	emtA	5.71e-157	1	203	1	203	membrane-bound lytic murein transglycosylase EmtA.
cd16893	LT_MltC_MltE	1.92e-82	41	199	1	160	membrane-bound lytic murein transglycosylases MltC and MltE, and similar proteins. MltC and MltE are periplasmic, outer membrane attached lytic transglycosylases (LTs), which cleave beta-1,4-glycosidic bonds joining N-acetylmuramic acid and N-acetylglucosamine in the cell wall peptidoglycan, yielding 1,6-anhydromuropeptides. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda
PRK11671	mltC	2.47e-54	34	199	187	352	membrane-bound lytic murein transglycosylase MltC.
pfam01464	SLT	2.87e-32	43	168	1	114	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.
COG0741	MltE	4.58e-27	1	201	93	296	Soluble lytic murein transglycosylase and related regulatory proteins (some contain LysM/invasin domains) [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QLN00631.1	1.21e-148	1	203	1	203
CAQ89277.1	1.21e-148	1	203	1	203
QCZ32075.1	1.21e-148	1	203	1	203
QKD65584.1	1.21e-148	1	203	1	203
QIE82413.1	8.12e-138	1	203	1	203

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3T36_A	2.21e-125	17	203	17	203	Crystalstructure of lytic transglycosylase MltE from Eschericha coli [Escherichia coli K-12],3T36_B Crystal structure of lytic transglycosylase MltE from Eschericha coli [Escherichia coli K-12],3T36_C Crystal structure of lytic transglycosylase MltE from Eschericha coli [Escherichia coli K-12],3T36_D Crystal structure of lytic transglycosylase MltE from Eschericha coli [Escherichia coli K-12],3T36_E Crystal structure of lytic transglycosylase MltE from Eschericha coli [Escherichia coli K-12],4HJV_A Crystal structure of E. coli MltE with bound bulgecin and murodipeptide [Escherichia coli K-12],4HJV_B Crystal structure of E. coli MltE with bound bulgecin and murodipeptide [Escherichia coli K-12],4HJV_C Crystal structure of E. coli MltE with bound bulgecin and murodipeptide [Escherichia coli K-12],4HJV_D Crystal structure of E. coli MltE with bound bulgecin and murodipeptide [Escherichia coli K-12],4HJV_E Crystal structure of E. coli MltE with bound bulgecin and murodipeptide [Escherichia coli K-12]
2Y8P_A	3.24e-125	19	203	2	186	CrystalStructure of an Outer Membrane-Anchored Endolytic Peptidoglycan Lytic Transglycosylase (MltE) from Escherichia coli [Escherichia coli K-12],2Y8P_B Crystal Structure of an Outer Membrane-Anchored Endolytic Peptidoglycan Lytic Transglycosylase (MltE) from Escherichia coli [Escherichia coli K-12]
4HJY_A	7.03e-125	17	203	20	206	2.4A Crystal structure of E. coli MltE-E64Q with bound chitopentaose [Escherichia coli K-12],4HJY_B 2.4 A Crystal structure of E. coli MltE-E64Q with bound chitopentaose [Escherichia coli K-12],4HJZ_A 1.9 A Crystal structure of E. coli MltE-E64Q with bound chitopentaose [Escherichia coli K-12],4HJZ_B 1.9 A Crystal structure of E. coli MltE-E64Q with bound chitopentaose [Escherichia coli K-12]
6GHY_A	9.29e-125	19	203	2	186	Structureof Lytic Transglycosylase MltE inactive mutant E64Q from E.coli [Escherichia coli K-12],6GHY_B Structure of Lytic Transglycosylase MltE inactive mutant E64Q from E.coli [Escherichia coli K-12]
6GI3_B	9.29e-125	19	203	2	186	Structureof Lytic Transglycosylase MltE mutant S73A from E.coli [Escherichia coli]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
B7LSJ1	2.42e-149	1	203	1	203	Endo-type membrane-bound lytic murein transglycosylase A OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73) OX=585054 GN=emtA PE=3 SV=1
Q83RP9	3.28e-138	1	203	1	203	Endo-type membrane-bound lytic murein transglycosylase A OS=Shigella flexneri OX=623 GN=emtA PE=3 SV=2
B7LXA7	3.28e-138	1	203	1	203	Endo-type membrane-bound lytic murein transglycosylase A OS=Escherichia coli O8 (strain IAI1) OX=585034 GN=emtA PE=3 SV=1
B7N3Z9	3.28e-138	1	203	1	203	Endo-type membrane-bound lytic murein transglycosylase A OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) OX=585056 GN=emtA PE=3 SV=1
Q0T5K7	3.28e-138	1	203	1	203	Endo-type membrane-bound lytic murein transglycosylase A OS=Shigella flexneri serotype 5b (strain 8401) OX=373384 GN=emtA PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000000	1.000083	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002515_01697.