CAZyme Information: MGYG000002515_03092

Basic Information

• Species: Escherichia fergusonii
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Escherichia; Escherichia fergusonii
• CAZyme ID: MGYG000002515_03092
• CAZy Family: GT51
• CAZyme Description: Biosynthetic peptidoglycan transglycosylase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
241	MGYG000002515_1|CGC30	27196.44	10.3415

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002515	4643861	Isolate	not provided	not provided

• Gene Location: Start: 3268490; End: 3269215 Strand: -

Full Sequence      

MSVRRFLPSFLRRFLWRALMILALFWGGGIALFSIVPVPYSAVMAERQVSAWFHGDFSYV
AHSDWVSMDEISPWLGLAVIAAEDQTFPDHWGFDIASIEKALAQNERHPARIRGASTLTQ
QTAKNLFLWDGRSWLRKGLEAGLTLGIETVWSKKRILTVYLNIAEFGDGVFGVEAAAQRY
FHKPASKLTASEAALLAAVLPNPLRFKVSAPSGYVRSRQAWILRQMRQLGGESFMTQHHL
Y

Enzyme Prediction     

EC	2.4.1.129

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT51	60	227	2.3e-56	0.943502824858757

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00056	mtgA	1.73e-144	4	239	1	236	monofunctional biosynthetic peptidoglycan transglycosylase; Provisional
TIGR02070	mono_pep_trsgly	3.75e-92	4	232	1	224	monofunctional biosynthetic peptidoglycan transglycosylase. This family is one of the transglycosylases involved in the late stages of peptidoglycan biosynthesis. Members tend to be small, about 240 amino acids in length, and consist almost entirely of a domain described by pfam00912 for transglycosylases. Species with this protein will have several other transglycosylases as well. All species with this protein are Proteobacteria that produce murein (peptidoglycan). [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]
COG0744	MrcB	2.64e-83	10	233	7	247	Membrane carboxypeptidase (penicillin-binding protein) [Cell wall/membrane/envelope biogenesis].
pfam00912	Transgly	2.67e-73	59	227	9	177	Transglycosylase. The penicillin-binding proteins are bifunctional proteins consisting of transglycosylase and transpeptidase in the N- and C-terminus respectively. The transglycosylase domain catalyzes the polymerization of murein glycan chains.
COG5009	MrcA	5.17e-41	66	230	70	234	Membrane carboxypeptidase/penicillin-binding protein [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAQ90678.1	5.68e-175	1	241	1	241
QCZ30872.1	5.45e-173	1	241	1	241
QKD66954.1	7.75e-173	1	241	1	241
QLN01934.1	4.48e-172	1	241	1	241
QEQ76909.1	3.96e-148	9	240	10	241

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2OQO_A	4.06e-28	65	230	22	187	Crystalstructure of a peptidoglycan glycosyltransferase from a class A PBP: insight into bacterial cell wall synthesis [Aquifex aeolicus VF5],3D3H_A Crystal structure of a complex of the peptidoglycan glycosyltransferase domain from Aquifex aeolicus and neryl moenomycin A [Aquifex aeolicus],3NB7_A Crystal structure of Aquifex Aeolicus Peptidoglycan Glycosyltransferase in complex with Decarboxylated Neryl Moenomycin [Aquifex aeolicus]
3NB6_A	1.58e-27	65	230	22	187	Crystalstructure of Aquifex aeolicus peptidoglycan glycosyltransferase in complex with Methylphosphoryl Neryl Moenomycin [Aquifex aeolicus]
4OON_A	1.07e-23	78	230	54	206	Crystalstructure of PBP1a in complex with compound 17 ((4Z,8S,11E,14S)-5-(2-amino-1,3-thiazol-4-yl)-14-(5,6-dihydroxy-1,3-dioxo-1,3-dihydro-2H-isoindol-2-yl)-8-formyl-2-methyl-6-oxo-3,10-dioxa-4,7,11-triazatetradeca-4,11-diene-2,12,14-tricarboxylic acid) [Pseudomonas aeruginosa PAO1]
3UDF_A	1.32e-19	39	230	20	206	ChainA, Penicillin-binding protein 1a [Acinetobacter baumannii],3UDF_B Chain B, Penicillin-binding protein 1a [Acinetobacter baumannii],3UDI_A Chain A, Penicillin-binding protein 1a [Acinetobacter baumannii],3UDI_B Chain B, Penicillin-binding protein 1a [Acinetobacter baumannii],3UDX_A Chain A, Penicillin-binding protein 1a [Acinetobacter baumannii],3UDX_B Chain B, Penicillin-binding protein 1a [Acinetobacter baumannii],3UE0_A Chain A, Penicillin-binding protein 1a [Acinetobacter baumannii],3UE0_B Chain B, Penicillin-binding protein 1a [Acinetobacter baumannii],3UE1_A Chain A, Penicillin-binding protein 1a [Acinetobacter baumannii],3UE1_B Chain B, Penicillin-binding protein 1a [Acinetobacter baumannii]
5U2G_A	1.37e-19	78	203	55	180	2.6Angstrom Resolution Crystal Structure of Penicillin-Binding Protein 1A from Haemophilus influenzae [Haemophilus influenzae Rd KW20],5U2G_B 2.6 Angstrom Resolution Crystal Structure of Penicillin-Binding Protein 1A from Haemophilus influenzae [Haemophilus influenzae Rd KW20]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
B7NDJ2	3.76e-147	9	240	10	241	Biosynthetic peptidoglycan transglycosylase OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) OX=585056 GN=mtgA PE=3 SV=1
Q32BC5	5.34e-147	9	240	10	241	Biosynthetic peptidoglycan transglycosylase OS=Shigella dysenteriae serotype 1 (strain Sd197) OX=300267 GN=mtgA PE=3 SV=1
B7MBX7	1.53e-146	9	240	10	241	Biosynthetic peptidoglycan transglycosylase OS=Escherichia coli O45:K1 (strain S88 / ExPEC) OX=585035 GN=mtgA PE=3 SV=1
Q0TCQ1	1.53e-146	9	240	10	241	Biosynthetic peptidoglycan transglycosylase OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) OX=362663 GN=mtgA PE=3 SV=1
B7M0S6	1.53e-146	9	240	10	241	Biosynthetic peptidoglycan transglycosylase OS=Escherichia coli O8 (strain IAI1) OX=585034 GN=mtgA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999997	0.000028	0.000001	0.000000	0.000000	0.000008

TMHMM  Annotations     

start	end
21	43