CAZyme Information: MGYG000002516_00524

Basic Information

• Species: Proteus vulgaris
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Proteus; Proteus vulgaris
• CAZyme ID: MGYG000002516_00524
• CAZy Family: GT9
• CAZyme Description: Lipopolysaccharide core heptosyltransferase RfaQ

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
343	MGYG000002516_1|CGC4	38532.62	9.3105

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002516	3639158	Isolate	Denmark	Europe

• Gene Location: Start: 528889; End: 529920 Strand: -

Full Sequence      

MPKILIIQRDNIGDLILTTPLIDSLAHEYNTKIDLLVNSYNQAILEGNPSVGNIHVYSKL
HHKKSGQSSLKLILSRLKIILDMRRQHYDVAIIARDHWAKRALQWAKLSGAKRIVAIGND
TPSAVTDPIPTPSNRGHIAELFCQLSHPLGIEKKAGPLKLYVKDEEIATIRQRIKITENI
PIYGLQISSRKPQQRWQAEKFIALAHQLTQREKCHILLFWSPGRSDNKLHPGDDEKAQFI
LEQCKNIPITPVPTQNLRELMAGMSLCDQMLTSDGGALHISVGVGVPTVAMFGNSDADFW
GPWHIANEVLKAPENNVELLTVDDVFTRFITLRNRIIALDTKS

Enzyme Prediction     

No EC number prediction in MGYG000002516_00524.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT9	79	313	1.4e-37	0.8933333333333333

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG0859	RfaF	2.29e-42	1	327	1	324	ADP-heptose:LPS heptosyltransferase [Cell wall/membrane/envelope biogenesis].
cd03789	GT9_LPS_heptosyltransferase	4.35e-42	3	315	1	245	lipopolysaccharide heptosyltransferase and similar proteins. Lipopolysaccharide heptosyltransferase (2.4.99.B6) is involved in the biosynthesis of lipooligosaccharide (LOS). Lipopolysaccharide (LPS) is a major component of the outer membrane of gram-negative bacteria. LPS heptosyltransferase transfers heptose molecules from ADP-heptose to 3-deoxy-D-manno-octulosonic acid (KDO), a part of the inner core component of LPS. This family also contains lipopolysaccharide 1,2-N-acetylglucosaminetransferase EC 2.4.1.56 and belongs to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.
pfam01075	Glyco_transf_9	3.50e-22	76	303	1	220	Glycosyltransferase family 9 (heptosyltransferase). Members of this family belong to glycosyltransferase family 9. Lipopolysaccharide is a major component of the outer leaflet of the outer membrane in Gram-negative bacteria. It is composed of three domains; lipid A, Core oligosaccharide and the O-antigen. All of these enzymes transfer heptose to the lipopolysaccharide core.
PRK10422	PRK10422	9.55e-20	3	303	7	299	lipopolysaccharide core biosynthesis protein; Provisional
PRK10916	PRK10916	4.91e-08	157	302	154	297	ADP-heptose--LPS heptosyltransferase RfaF.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AYY80883.1	6.08e-253	1	343	1	343
QKD74379.1	5.59e-249	1	343	1	343
QKD69219.1	5.59e-249	1	343	1	343
QPT33783.1	1.14e-232	1	343	1	343
QIG05865.1	4.64e-232	1	343	1	343

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3TOV_A	2.37e-14	3	315	10	310	Thecrystal structure of the glycosyl transferase family 9 from Veillonella parvula DSM 2008 [Veillonella parvula DSM 2008],3TOV_B The crystal structure of the glycosyl transferase family 9 from Veillonella parvula DSM 2008 [Veillonella parvula DSM 2008]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9R9D5	6.33e-11	13	303	5	287	Lipopolysaccharide core heptosyltransferase RfaQ OS=Escherichia coli OX=562 GN=rfaQ PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000063	0.000002	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002516_00524.