CAZyme Information: MGYG000002516_01734

Basic Information

• Species: Proteus vulgaris
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Proteus; Proteus vulgaris
• CAZyme ID: MGYG000002516_01734
• CAZy Family: GH105
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
353	MGYG000002516_1|CGC16	40761.01	5.2591

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002516	3639158	Isolate	Denmark	Europe

• Gene Location: Start: 1845476; End: 1846537 Strand: -

Full Sequence      

MEHANTDTLQRELVLQNMKRVYRYQSANQVRSVRRRSGKTRFIKDTDWERGVLWSCVSAA
WQATQDEEYLNGVLNYTLHTGFRTGPNARFADDHVCAQAYLAISPLFEHSEVIEPTIKAF
DIMLNDPKPGREDWWWCDALFMAPPGFAALAEMTSERRYLDYMHTAYWDAIEHLRDPETG
LIFRDHRYIPDGQGNELREANGEKVFWSRGIGWVLASIPRILKYMPDDYHGRERYIALFK
ELATSILDYQHEDGFWRTSLLDPDNFPAPESSATALFCYGLAWGINQGILEKEIYFPALN
KAWSALQTCIHDNGMIGWVQLPAFNPREVKFEHNMDYGAGAYLLAGSEVLNLL

Enzyme Prediction     

No EC number prediction in MGYG000002516_01734.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	40	350	2e-85	0.9759036144578314

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4225	YesR	7.19e-112	17	353	7	357	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].
pfam07470	Glyco_hydro_88	7.69e-73	47	353	28	343	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.
PRK10996	PRK10996	0.005	86	152	15	79	thioredoxin 2; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AYY81684.1	2.66e-277	1	353	1	353
QIG05302.1	5.77e-272	1	353	1	353
QPB80441.1	1.93e-270	1	353	1	353
QQP26448.1	1.93e-270	1	353	1	353
QKD68654.1	5.54e-270	1	353	1	353

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4CE7_A	4.60e-82	43	352	48	369	Crystalstructure of a novel unsaturated beta-glucuronyl hydrolase enzyme, belonging to family GH105, involved in ulvan degradation [Nonlabens ulvanivorans],4CE7_B Crystal structure of a novel unsaturated beta-glucuronyl hydrolase enzyme, belonging to family GH105, involved in ulvan degradation [Nonlabens ulvanivorans],4CE7_C Crystal structure of a novel unsaturated beta-glucuronyl hydrolase enzyme, belonging to family GH105, involved in ulvan degradation [Nonlabens ulvanivorans]
5NOA_A	1.95e-52	90	353	114	375	PolysaccharideLyase BACCELL_00875 [Bacteroides thetaiotaomicron]
4Q88_A	8.70e-47	90	353	97	358	ChainA, Uncharacterized protein [Phocaeicola vulgatus ATCC 8482],4Q88_B Chain B, Uncharacterized protein [Phocaeicola vulgatus ATCC 8482]
3K11_A	2.86e-15	136	353	200	414	Crystalstructure of Putative glycosyl hydrolase (NP_813087.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 1.80 A resolution [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
L7P9J4	3.10e-81	43	352	55	376	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Nonlabens ulvanivorans OX=906888 GN=IL45_01505 PE=1 SV=1
T2KPL9	7.80e-79	43	352	53	375	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22220 PE=2 SV=1
P9WF04	7.44e-66	91	350	136	409	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_28 PE=1 SV=1
O31521	4.07e-10	47	350	30	336	Unsaturated rhamnogalacturonyl hydrolase YesR OS=Bacillus subtilis (strain 168) OX=224308 GN=yesR PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000071	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002516_01734.