CAZyme Information: MGYG000002516_03092

Basic Information

• Species: Proteus vulgaris
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Proteus; Proteus vulgaris
• CAZyme ID: MGYG000002516_03092
• CAZy Family: GT25
• CAZyme Description: Lipooligosaccharide biosynthesis protein lex-1

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
273	MGYG000002516_5|CGC3	32235.34	9.8812

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002516	3639158	Isolate	Denmark	Europe

• Gene Location: Start: 168994; End: 169815 Strand: -

Full Sequence      

MFPLRYYLYKEYYMNNFIISLKDNNEKRRKHISNQFNSKNIPFLFFDAINKNNLDTSEHL
NISFNNPNLTAGEKGCFLSHIFLWKKIIDEDIDVAGIFEDDIYLGKNSEKLLSNYSWVNK
NIDIIKIEKSNDKIKTSIRPIKKIMNIQIVRLKSRHLGTAGYIITNKGAHFLFDKIAQKP
IKNPIDHEIFNDLLIDNKYIVGQTMPCLCIQDFVLNKNDNNFPSILEDNRIHRVIHKIGN
NNKIIRELSRLKEQVLDFTLKNTIERKVYFHLK

Enzyme Prediction     

No EC number prediction in MGYG000002516_03092.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT25	15	187	8.6e-36	0.9723756906077348

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3306	COG3306	7.62e-35	14	221	3	219	Glycosyltransferase involved in LPS biosynthesis, GR25 family [Cell wall/membrane/envelope biogenesis].
pfam01755	Glyco_transf_25	8.73e-35	16	187	4	198	Glycosyltransferase family 25 (LPS biosynthesis protein). Members of this family belong to Glycosyltransferase family 25 This is a family of glycosyltransferases involved in lipopolysaccharide (LPS) biosynthesis. These enzymes catalyze the transfer of various sugars onto the growing LPS chain during its biosynthesis.
cd06532	Glyco_transf_25	9.29e-30	16	189	2	128	Glycosyltransferase family 25 [lipooligosaccharide (LOS) biosynthesis protein] is a family of glycosyltransferases involved in LOS biosynthesis. The members include the beta(1,4) galactosyltransferases: Lgt2 of Moraxella catarrhalis, LgtB and LgtE of Neisseria gonorrhoeae and Lic2A of Haemophilus influenzae. M. catarrhalis Lgt2 catalyzes the addition of galactose (Gal) to the growing chain of LOS on the cell surface. N. gonorrhoeae LgtB and LgtE link Gal-beta(1,4) to GlcNAc (N-acetylglucosamine) and Glc (glucose), respectively. The genes encoding LgtB and LgtE are two genes of a five gene locus involved in the synthesis of gonococcal LOS. LgtE is believed to perform the first step in LOS biosynthesis.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
VTP79985.1	4.03e-200	1	273	1	273
QIF46807.1	5.67e-173	1	273	1	274
QKQ94181.1	5.67e-173	1	273	1	274
QJW49488.1	7.12e-173	14	273	1	261
QHD94220.1	7.12e-173	14	273	1	261

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q05770	5.87e-51	14	253	1	232	Lipooligosaccharide biosynthesis protein LpsA OS=Mannheimia haemolytica OX=75985 GN=lpsA PE=3 SV=2
Q57125	3.70e-40	15	252	33	271	Putative glycosyltransferase HI_0765 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=HI_0765 PE=3 SV=1
Q03974	1.88e-32	14	256	4	276	Lipooligosaccharide biosynthesis protein lex-1 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=lex1 PE=1 SV=1
Q51116	2.39e-29	14	231	1	230	Lacto-N-neotetraose biosynthesis glycosyltransferase LgtB OS=Neisseria meningitidis serogroup B (strain MC58) OX=122586 GN=lgtB PE=3 SV=2
P57033	2.71e-28	14	230	1	229	Lacto-N-neotetraose biosynthesis glycosyltransferase LgtB OS=Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491) OX=122587 GN=lgtB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000038	0.000003	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002516_03092.