CAZyme Information: MGYG000002517_00163

Basic Information

• Species: Roseburia hominis
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Roseburia; Roseburia hominis
• CAZyme ID: MGYG000002517_00163
• CAZy Family: GT2
• CAZyme Description: Ubiquinone biosynthesis O-methyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
579		66644.57	4.6084

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002517	3592125	Isolate	United Kingdom	Europe

• Gene Location: Start: 184475; End: 186214 Strand: +

Full Sequence      

MGYAGLKQLIEQNAWREAGRELGQYMNGEWDDELAVLAATVFSALGDWEGAYTCIAQGLQ
YNYKNYELYLLLGNYYERKNCNQAWLCYENALYYCSDEDDRRIIQQHKERVQQDDRWCVH
KVSIVILTYNLKDMNMQCIGSIRDTCDPSSYELVVVDNASTDGTLEWLREQKDMTLVSNQ
ENKGFPAGCNQGIKAAEPENDILLLNNDTIVLPNSIFWLRMGLYEEERIGATGSMSNSVI
NGQRIEAKLAGVEEYITYGTAMNIPMENALEKKTWLVGFAMLLKRKALDEVGLLDERFSP
GQNEDVDLCIRLNLAGWQMRLCHNSFIVHYGHGNGRNSDIWKQTFSVTSEKFREKWGFDM
SYYTYSRKELIAMISEPKESRIRVQEVGCGCGATLAHIAYEWPDAKVSGIEIQDDIAKIG
ANYLDIRQGNIETMQIPYEKDTFDYIILADVLEHLHDPERILQKLLPYLKADGSILCSVP
NILNRHVISDLLRGKLEYQDAGILDRTHLRFFTMDSIVRVFERCGMEVTQMMATYDTEEL
DAEAEELMNALYQIPHIADRQLFQVYQYVFRAKRGREAE

Enzyme Prediction     

No EC number prediction in MGYG000002517_00163.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1216	GT2	4.02e-43	120	341	3	232	Glycosyltransferase, GT2 family [Carbohydrate transport and metabolism].
cd04186	GT_2_like_c	6.14e-40	124	331	1	166	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
pfam13489	Methyltransf_23	6.40e-20	369	530	11	162	Methyltransferase domain. This family appears to be a methyltransferase domain.
cd00761	Glyco_tranf_GTA_type	1.58e-17	124	247	1	126	Glycosyltransferase family A (GT-A) includes diverse families of glycosyl transferases with a common GT-A type structural fold. Glycosyltransferases (GTs) are enzymes that synthesize oligosaccharides, polysaccharides, and glycoconjugates by transferring the sugar moiety from an activated nucleotide-sugar donor to an acceptor molecule, which may be a growing oligosaccharide, a lipid, or a protein. Based on the stereochemistry of the donor and acceptor molecules, GTs are classified as either retaining or inverting enzymes. To date, all GT structures adopt one of two possible folds, termed GT-A fold and GT-B fold. This hierarchy includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. The majority of the proteins in this superfamily are Glycosyltransferase family 2 (GT-2) proteins. But it also includes families GT-43, GT-6, GT-8, GT13 and GT-7; which are evolutionarily related to GT-2 and share structure similarities.
cd04185	GT_2_like_b	2.66e-16	125	342	2	191	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEN95288.1	0.0	1	579	1	579
CUU50244.1	2.87e-149	6	525	10	532
AYF39959.1	2.32e-130	119	575	3	457
ADU25709.1	2.32e-130	119	575	3	457
AVQ97293.1	2.32e-130	119	575	3	457

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3CC8_A	2.32e-31	346	547	4	199	Crystalstructure of a putative methyltransferase (bce_1332) from bacillus cereus atcc 10987 at 1.64 A resolution [Bacillus cereus ATCC 10987]
3MGG_A	2.66e-10	383	475	40	138	CrystalStructure of Methyl Transferase from Methanosarcina mazei [Methanosarcina mazei],3MGG_B Crystal Structure of Methyl Transferase from Methanosarcina mazei [Methanosarcina mazei]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O06483	7.14e-08	121	360	2	285	Uncharacterized glycosyltransferase YfnE OS=Bacillus subtilis (strain 168) OX=224308 GN=yfnE PE=3 SV=2
D4GYG7	3.48e-06	122	347	8	223	Glycosyltransferase AglE OS=Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2) OX=309800 GN=aglE PE=1 SV=1
A9VMC2	3.74e-06	350	531	14	218	Demethylmenaquinone methyltransferase OS=Bacillus mycoides (strain KBAB4) OX=315730 GN=menG PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000059	0.000002	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002517_00163.