CAZyme Information: MGYG000002517_00503

Basic Information

• Species: Roseburia hominis
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Roseburia; Roseburia hominis
• CAZyme ID: MGYG000002517_00503
• CAZy Family: GT26
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
229	MGYG000002517_1|CGC5	25966.5	4.7465

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002517	3592125	Isolate	United Kingdom	Europe

• Gene Location: Start: 556797; End: 557486 Strand: +

Full Sequence      

MIKKIDIMGIGLDNYTVRESMRQVENYLSNDVLNTIENISMQMLIASETDPVVHNVISEL
DLSVIGEKEILKAADADSMQRVQETEQNDFSYEFYRRIERNKRSIFVLGQTEEDVQKVKA
ELQEAFPKLILAGEYALENCVGNLDAVINEMNATTPDVIVSILPSPLQEHFFAEHKDKMS
ATIWFGMGELGVHGKKHGLGSFVKNRLHLGRLKNSMNKYQDQEKSGEAE

Enzyme Prediction     

No EC number prediction in MGYG000002517_00503.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT26	71	189	1.8e-16	0.6900584795321637

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam03808	Glyco_tran_WecB	4.32e-17	89	188	31	130	Glycosyl transferase WecB/TagA/CpsF family.
COG1922	WecG	1.82e-15	1	190	6	196	UDP-N-acetyl-D-mannosaminuronic acid transferase, WecB/TagA/CpsF family [Cell wall/membrane/envelope biogenesis].
cd06533	Glyco_transf_WecG_TagA	1.16e-14	89	188	33	132	The glycosyltransferase WecG/TagA superfamily contains Escherichia coli WecG, Bacillus subtilis TagA and related proteins. E. coli WecG is believed to be a UDP-N-acetyl-D-mannosaminuronic acid transferase, and is involved in enterobacterial common antigen (eca) synthesis. B. subtilis TagA plays a key role in the Wall Teichoic Acid (WTA) biosynthetic pathway, catalyzing the transfer of N-acetylmannosamine to the C4 hydroxyl of a membrane-anchored N-acetylglucosaminyl diphospholipid to make ManNAc-beta-(1,4)-GlcNAc-pp-undecaprenyl. This is the first committed step in this pathway. Also included in this group is Xanthomonas campestris pv. campestris GumM, a glycosyltransferase participating in the biosynthesis of the exopolysaccharide xanthan.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEN95637.1	7.82e-154	8	229	1	222
CBL12223.1	7.16e-87	1	220	21	240
CBL09922.1	7.16e-87	1	220	21	240
VCV20753.1	7.16e-87	1	220	21	240
ACR74497.1	3.14e-49	1	225	1	225

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000050	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002517_00503.