CAZyme Information: MGYG000002517_00812

Basic Information

• Species: Roseburia hominis
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Roseburia; Roseburia hominis
• CAZyme ID: MGYG000002517_00812
• CAZy Family: CBM67
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
731	MGYG000002517_1|CGC10	82931.69	4.7912

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002517	3592125	Isolate	United Kingdom	Europe

• Gene Location: Start: 881400; End: 883595 Strand: +

Full Sequence      

MTEEMSREKAEWSPQWLTIREFSHITPVNLFHKEQEEGEKQPEAEQQLTAEFRRNLHVLV
RARFTLETAQENLTLRLTADDHYKLYVESGFVAEGPAPGYPDHYYYNEIPLGKMEAGEHC
FGLHLYYQGLINRVYNSGDLRFAFATELMDAQDCRIPLRFCYERTDAYSGGTIGYDTQFL
ENFDSRKFPEGWSSAEFDDAGWKTPAAAEWADYRLYLQPTRMLCGERIKPEKVEIYEDGS
IRIDVGEEVAGSLCLTAEGSAGDTVEIFCGEELDESGSVRYEMRCNCSYHEIWTLSDGCC
SLEPYDYKGFRYAKLLPGKGVNICGIFVQTRHYPMEEGAEVTSSEKRLEQIFSICKNAVK
YGTQEGYVDCPTREKGQYLGDAVVTAHAQVLLTGETQMLLKCIDQFAQTRAVCPGLLAVA
PGGLMQEIADYSLMYPQLLALYYRYTGNAAALLPYYKTALGMIRHFAQYERADGLLVQVA
DKWNLVDWPENLRDEYDFALTRPVVGAGCHNVINALYLGAKKTLNGLARVLGREEPYELE
KPVFAYRRAFYRKETGLLADSETSSHTSLHSNVYALYFGLLEEAEEAPVIEFLEKRGFSC
GVMLSYYLLLALARRGRYESVYRLLLNDSDHGWCNMLREGATTCFEAWGKDQKWNTSLCH
PWASAPVPVILEEIAGIHLSPEGGCDFAPHIPKEVDYFHASVRVRGKMYTVTKQDGEIHA
AIDGIEQSKEM

Enzyme Prediction     

No EC number prediction in MGYG000002517_00812.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	237	704	7.5e-88	0.9265873015873016
CBM67	53	207	4.6e-20	0.8806818181818182

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	5.47e-30	336	666	1	332	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam05592	Bac_rhamnosid	0.002	238	315	5	84	Bacterial alpha-L-rhamnosidase concanavalin-like domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEN95938.1	0.0	1	731	14	744
VCV23259.1	0.0	1	722	18	782
CBL08197.1	0.0	4	722	3	765
CBL12709.1	0.0	1	722	5	769
QBE96895.1	1.73e-277	11	718	3	707

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2OKX_A	7.63e-21	229	689	425	893	Crystalstructure of GH78 family rhamnosidase of Bacillus SP. GL1 AT 1.9 A [Bacillus sp. GL1],2OKX_B Crystal structure of GH78 family rhamnosidase of Bacillus SP. GL1 AT 1.9 A [Bacillus sp. GL1]
3W5M_A	8.03e-13	167	652	423	901	CrystalStructure of Streptomyces avermitilis alpha-L-rhamnosidase [Streptomyces avermitilis MA-4680 = NBRC 14893],3W5N_A Crystal Structure of Streptomyces avermitilis alpha-L-rhamnosidase complexed with L-rhamnose [Streptomyces avermitilis MA-4680 = NBRC 14893]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KM26	4.66e-26	226	720	593	1110	Bifunctional sulfatase/alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22250 PE=1 SV=2
T2KPL4	5.83e-15	61	680	188	846	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22170 PE=2 SV=1
Q82PP4	4.38e-12	167	652	423	901	Alpha-L-rhamnosidase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) OX=227882 GN=SAVERM_828 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000055	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002517_00812.