CAZyme Information: MGYG000002517_02116

Basic Information

• Species: Roseburia hominis
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Roseburia; Roseburia hominis
• CAZyme ID: MGYG000002517_02116
• CAZy Family: CBM61
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
185	MGYG000002517_1|CGC28	19638.56	3.8434

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002517	3592125	Isolate	United Kingdom	Europe

• Gene Location: Start: 2329126; End: 2329683 Strand: -

Full Sequence      

MKKRMAGMLLVAGMMASLVGCGGADAAKTATADANGNYLVNGSFEEADFTGWTVTNIDDV
TEELDVYDRETDCFEGVQSLHFYSGSSNVNFSAEQTVSGLEDGSYKLTAHIQGEAAGDEN
AQAYFYAIVDGEEVKVDGELNGYVNWYTAELSGITPTDGKITVGIRVSTAPGGWGTIDDL
TLVKE

Enzyme Prediction     

No EC number prediction in MGYG000002517_02116.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CBM61	37	182	1.5e-31	0.9858156028368794

CDD Domains     

MGYG000002517_02116 has no CDD domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEN97261.1	1.23e-130	1	185	1	185
QNM03635.1	1.21e-101	1	185	1	187
BBF43149.1	1.59e-32	10	184	11	180
ALS74893.1	1.22e-28	37	184	509	653
QDY72601.1	1.61e-27	37	184	668	812

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2XOM_A	2.54e-09	37	185	9	151	Atomicresolution structure of TmCBM61 in complex with beta-1,4- galactotriose [Thermotoga maritima],2XON_A Structure of TmCBM61 in complex with beta-1,4-galactotriose at 1.4 A resolution [Thermotoga maritima],2XON_L Structure of TmCBM61 in complex with beta-1,4-galactotriose at 1.4 A resolution [Thermotoga maritima]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000000	1.000051	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002517_02116.