CAZyme Information: MGYG000002517_02879

Basic Information

• Species: Roseburia hominis
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Roseburia; Roseburia hominis
• CAZyme ID: MGYG000002517_02879
• CAZy Family: GH79
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
509	MGYG000002517_1|CGC42	55617.44	4.4042

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002517	3592125	Isolate	United Kingdom	Europe

• Gene Location: Start: 3149714; End: 3151243 Strand: +

Full Sequence      

MAQFVKLVPENLKALREVNPRLMSYNVEFAEVTGGTFWKAYTPEQVAGTEEFHVAPSADG
IAAMYKDLMQVYAPIDLYNEKLRSLAKELGTAWVRVSGTWATKTYYDFDNATGGIAPEGY
LNVLTKEQWIGVLDFVKAIDAKLMISVANCPGLHSAEEPWNPSEAEKIFRLSKEHGVPID
GAEFANEPNMMEDTGFPAGYTPADYHRDQDLFFAWVRANYPECICIGPSSVGEGLTINGG
DDNSKSGGIEQLVRENCSTTDLLEDTKEPLDVFSYHYYNGVSERLASVMPSGHWLADTAH
TEAYLDVALNCARTYAPLRDKYCPGGEMWVTESGDAGGGGDTWASTYLDVFRTLNELAGF
AAITDGVIFHNTLASSDYGFLAREVFDPRPNYFAVLLWNRLMGTTVYDTAEPLREGAHVF
AHSRKDGKEGVVYLVINNSLTETTTVELPKSAERYTLAGEGGNVRAAVMTLNGKPLVLGA
GNSLPELTPAAQEAGTVTLAPATCTFFVL

Enzyme Prediction     

No EC number prediction in MGYG000002517_02879.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH79	74	509	3.2e-73	0.9428571428571428

CDD Domains     

MGYG000002517_02879 has no CDD domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEN98036.1	0.0	1	509	1	509
SNU86930.1	2.31e-262	1	509	1	507
SQG83426.1	3.50e-255	1	509	1	509
AUC25236.1	3.50e-255	1	509	1	509
SQG46560.1	1.42e-254	1	509	1	509

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7RG8_A	6.08e-10	143	509	16	378	ChainA, Heparanase 50 kDa subunit [Homo sapiens]
5E8M_A	2.45e-08	143	509	18	380	Crystalstructure of human heparanase [Homo sapiens],5E97_A Glycoside Hydrolase ligand structure 1 [Homo sapiens],5E98_A Crystal structure of human heparanase in complex with HepMer M04S02a [Homo sapiens],5E9B_A Crystal structure of human heparanase in complex with HepMer M09S05a [Homo sapiens],5E9C_A Crystal structure of human heparanase in complex with heparin tetrasaccharide dp4 [Homo sapiens],5L9Y_A Crystal structure of human heparanase, in complex with glucuronic acid configured aziridine probe JJB355 [Homo sapiens],6ZDM_AAA Chain AAA, Heparanase [Homo sapiens]
5LA4_A	3.17e-08	143	509	138	500	Crystalstructure of apo human proheparanase [Homo sapiens],5LA7_A Crystal structure of human proheparanase, in complex with glucuronic acid configured aziridine probe JJB355 [Homo sapiens]
5L9Z_A	5.73e-08	143	509	18	380	Crystalstructure of human heparanase nucleophile mutant (E343Q), in complex with unreacted glucuronic acid configured aziridine probe JJB355 [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
X4Y2L4	1.83e-17	75	509	40	479	Hyaluronoglucuronidase OS=Hirudo nipponia OX=42736 PE=1 SV=1
Q9LRC8	2.11e-17	75	493	73	495	Baicalin-beta-D-glucuronidase OS=Scutellaria baicalensis OX=65409 GN=SGUS PE=1 SV=1
Q8L608	5.03e-16	270	509	261	530	Heparanase-like protein 2 OS=Arabidopsis thaliana OX=3702 GN=At5g61250 PE=2 SV=1
Q8WWQ2	2.37e-10	123	509	187	581	Inactive heparanase-2 OS=Homo sapiens OX=9606 GN=HPSE2 PE=1 SV=3
B2RY83	4.15e-10	123	509	187	581	Inactive heparanase-2 OS=Mus musculus OX=10090 GN=Hpse2 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000065	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002517_02879.