CAZyme Information: MGYG000002518_01240

Basic Information

• Species: Serratia surfactantfaciens
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Serratia; Serratia surfactantfaciens
• CAZyme ID: MGYG000002518_01240
• CAZy Family: GT44
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
363	MGYG000002518_11|CGC14	42719.6	8.431

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002518	5076569	Isolate	India	Asia

• Gene Location: Start: 1133479; End: 1134570 Strand: -

Full Sequence      

MSFAKQCHTRFRQRQKNKFKVELKIKNHAFNYIYPKIMEGFSFDELVVAFLIENKIPYQK
PPRAIEDVWFESRGFTKKCITEIFCNGFDDFMRYYYYEIILRCNLASASDIIRLLIIYQY
GGTYVDVDTLPYTDNLYHRLNKHIEEEGIIESDSLLLFKTVCFLKKTNSEELWPAAVIGC
DENELRVDAVGFEKIKQLVKQDLSGFSLDMILPLGETYVHKNLLALGSLRKFKGVYFNNF
ISSHQKSKAIRIILRTMKKRYRFLEKSNCIFDCYVDDKPKCYLTRLLTWRTELTTRDYCV
TKVLTGPGLIVEVLLGLVYKIFNIEYSVEPHTIAEYMQNSDFGIVLFQHNIDTPDGVYST
WRK

Enzyme Prediction     

No EC number prediction in MGYG000002518_01240.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam12919	TcdA_TcdB	6.40e-14	95	267	160	319	TcdA/TcdB catalytic glycosyltransferase domain. This domain represents the N-terminal glycosyltransferase from a set of toxins found in some bacteria. This domain in TcdB glycosylates the host RhoA protein.
NF033479	Efa1_rel_toxin	3.43e-04	95	131	474	510	LifA/Efa1-related large cytotoxin. Members of this family are large and almost certainly multifunctional proteins found in various pathogens from genus Chlamydia, about 3000 amino acids in size and related to lymphostatin (Efa1/LifA) from enteropathogenic Escherichia coli. Roles have been suggested for Efa1 (EHEC factor for adherence) in adhesion, so some members have been annotated as adherence proteins rather than cytotoxins.
pfam04488	Gly_transf_sug	0.004	104	131	52	79	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QJU40017.1	2.23e-250	15	363	75	423
AYU90395.1	4.30e-248	15	363	75	423
QHC45062.1	3.96e-219	16	363	78	425
AUY14894.1	6.54e-218	16	363	78	425
QDI47672.1	1.87e-217	16	363	78	425

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2VK9_A	3.12e-11	18	264	183	412	CrystalStructure Of The Catalytic Domain Of Alpha-Toxin From Clostridium Novyi [Clostridium novyi]
7U2P_A	1.21e-07	90	266	250	412	ChainA, Glucosyltransferase TcdA [Clostridioides difficile]
3SRZ_A	1.22e-07	90	266	249	411	ChainA, Toxin A [Clostridioides difficile 630],3SS1_A Chain A, Toxin A [Clostridioides difficile 630]
4DMV_A	1.22e-07	90	266	264	426	ChainA, Toxin A [Clostridioides difficile],4DMW_A Chain A, Toxin A [Clostridioides difficile]
5UQK_A	1.23e-07	90	266	249	411	ChainA, Toxin A [Clostridioides difficile],5UQL_A Chain A, Toxin A [Clostridioides difficile]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q46149	2.55e-10	18	264	183	412	Toxin A OS=Clostridium novyi OX=1542 GN=tcdA PE=1 SV=1
P16154	9.43e-07	90	266	249	411	Toxin A OS=Clostridioides difficile OX=1496 GN=tcdA PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000066	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002518_01240.