CAZyme Information: MGYG000002520_00324

Basic Information

• Species: Pluralibacter gergoviae
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Pluralibacter; Pluralibacter gergoviae
• CAZyme ID: MGYG000002520_00324
• CAZy Family: GT51
• CAZyme Description: Biosynthetic peptidoglycan transglycosylase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
241	MGYG000002520_1|CGC5	26863.05	10.8375

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002520	5408082	Isolate	United States	North America

• Gene Location: Start: 348233; End: 348958 Strand: -

Full Sequence      

MSQRRSPAGWLRRILLRAVLLLAVVWGGGILLFSVVPVPFSAVMVERQLGAWLSGDFGYV
AHSDWVGMDEISPWMGLAVIAAEDQKFPEHWGFDVAAIEKALAHNERSDSRIRGASTLSQ
QTAKNVFLWDGRSWLRKGLEAGLTVGIETVWSKRRILTVYLNVAEFGNGVFGVEAAAQRY
FHKPASRLTMSEAALLAAVLPNPLRFRADAPSGYVRSRQAWIMRQMGQLGGEGFMDRHRL
R

Enzyme Prediction     

EC	2.4.1.129

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT51	60	226	8.8e-56	0.9378531073446328

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00056	mtgA	9.03e-141	4	239	1	236	monofunctional biosynthetic peptidoglycan transglycosylase; Provisional
TIGR02070	mono_pep_trsgly	1.51e-95	30	232	22	224	monofunctional biosynthetic peptidoglycan transglycosylase. This family is one of the transglycosylases involved in the late stages of peptidoglycan biosynthesis. Members tend to be small, about 240 amino acids in length, and consist almost entirely of a domain described by pfam00912 for transglycosylases. Species with this protein will have several other transglycosylases as well. All species with this protein are Proteobacteria that produce murein (peptidoglycan). [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]
COG0744	MrcB	4.86e-82	30	241	43	255	Membrane carboxypeptidase (penicillin-binding protein) [Cell wall/membrane/envelope biogenesis].
pfam00912	Transgly	2.91e-72	59	226	9	176	Transglycosylase. The penicillin-binding proteins are bifunctional proteins consisting of transglycosylase and transpeptidase in the N- and C-terminus respectively. The transglycosylase domain catalyzes the polymerization of murein glycan chains.
COG5009	MrcA	1.43e-38	66	230	70	234	Membrane carboxypeptidase/penicillin-binding protein [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AVR01519.1	4.00e-175	1	241	1	241
AIQ98611.1	5.45e-173	1	241	1	241
AVY97466.1	5.27e-153	1	240	1	240
AVU52409.1	1.03e-152	1	240	1	240
AIX60811.1	1.03e-152	1	240	1	240

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2OQO_A	2.89e-28	65	230	22	187	Crystalstructure of a peptidoglycan glycosyltransferase from a class A PBP: insight into bacterial cell wall synthesis [Aquifex aeolicus VF5],3D3H_A Crystal structure of a complex of the peptidoglycan glycosyltransferase domain from Aquifex aeolicus and neryl moenomycin A [Aquifex aeolicus],3NB7_A Crystal structure of Aquifex Aeolicus Peptidoglycan Glycosyltransferase in complex with Decarboxylated Neryl Moenomycin [Aquifex aeolicus]
3NB6_A	1.13e-27	65	230	22	187	Crystalstructure of Aquifex aeolicus peptidoglycan glycosyltransferase in complex with Methylphosphoryl Neryl Moenomycin [Aquifex aeolicus]
4OON_A	2.33e-24	78	239	54	212	Crystalstructure of PBP1a in complex with compound 17 ((4Z,8S,11E,14S)-5-(2-amino-1,3-thiazol-4-yl)-14-(5,6-dihydroxy-1,3-dioxo-1,3-dihydro-2H-isoindol-2-yl)-8-formyl-2-methyl-6-oxo-3,10-dioxa-4,7,11-triazatetradeca-4,11-diene-2,12,14-tricarboxylic acid) [Pseudomonas aeruginosa PAO1]
5U2G_A	1.64e-20	78	203	55	180	2.6Angstrom Resolution Crystal Structure of Penicillin-Binding Protein 1A from Haemophilus influenzae [Haemophilus influenzae Rd KW20],5U2G_B 2.6 Angstrom Resolution Crystal Structure of Penicillin-Binding Protein 1A from Haemophilus influenzae [Haemophilus influenzae Rd KW20]
7U4H_A	1.04e-19	78	206	55	181	ChainA, Penicillin-binding protein 1A (Pbp1a) [Chlamydia trachomatis D/UW-3/CX],7U4H_B Chain B, Penicillin-binding protein 1A (Pbp1a) [Chlamydia trachomatis D/UW-3/CX]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
B4TWH8	2.65e-147	1	240	1	241	Biosynthetic peptidoglycan transglycosylase OS=Salmonella schwarzengrund (strain CVM19633) OX=439843 GN=mtgA PE=3 SV=1
A8AQ99	2.65e-147	4	240	5	241	Biosynthetic peptidoglycan transglycosylase OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) OX=290338 GN=mtgA PE=3 SV=1
B5F6X7	5.34e-147	1	240	1	241	Biosynthetic peptidoglycan transglycosylase OS=Salmonella agona (strain SL483) OX=454166 GN=mtgA PE=3 SV=1
A9N776	1.08e-146	1	240	1	241	Biosynthetic peptidoglycan transglycosylase OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) OX=1016998 GN=mtgA PE=3 SV=1
B5R0J9	1.53e-146	1	240	1	241	Biosynthetic peptidoglycan transglycosylase OS=Salmonella enteritidis PT4 (strain P125109) OX=550537 GN=mtgA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999827	0.000111	0.000002	0.000000	0.000000	0.000085

TMHMM  Annotations     

start	end
13	35