CAZyme Information: MGYG000002520_01206

Basic Information

• Species: Pluralibacter gergoviae
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Pluralibacter; Pluralibacter gergoviae
• CAZyme ID: MGYG000002520_01206
• CAZy Family: GH108
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
850	MGYG000002520_1|CGC17	93184.13	6.7227

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002520	5408082	Isolate	United States	North America

• Gene Location: Start: 1304585; End: 1307137 Strand: +

Full Sequence      

MLNRITVTLPAGELLFWKLSGREAISESFELSLTLLGTDARIDRSRLLGQPVTVTIPTQS
LLSPRYINGKVTRVAVSATELSGTRYAVYTLTVEPDLWPMKRDRNLRIFQGQTVPQIVKT
LLGEYQVNLEDKLTGSYRTWEYCVQYQESSFAFISRLMELEGIAYHFKHEADKHTLVLTD
AEGSFEPFSGYEIIPYHQTPSGGSTSEEGISQWALADSVTPGIYSLDDYDFRKPNAWLFQ
ARQNPASPVPGSIDVYDWPGRFVEHGHGEFYARIRQERWQVEHQQISGTATAMGIAPGNT
FALTSAPFFSDNGQYLTTAADYQFEENRYASGDGGETIHRTEFTVIPAAVVYRPAQGTAW
PRTYGPQTARVVGPQGESIWTDRYGRIKVKFHWDRLAKGDDTSSCWVRVSSAWAGQGFGG
VQIPRVGDEVVIDFINGDPDRPLVTGRVYNEASMPPWALPAAATQMGFLSRTKDGSSETA
NALRFEDKAGEEQVWIQAQKNLDTNVKNDETHSVGGARSHYVAKNELHRVESNQTQAVKG
GTEILTGKGKLDAAVEKYEIASGTMLRLVSGESAIELNANGTISLIGKSFNFFVEKEGYI
TTGEKLHLNTSKASPGTSAPGEDHKGNIEAAVKEFFTPGKQGESSAASASASAAPAKNVP
FAAKPGRIDNRVVKSVMASEGSAGEQGGRRELYGFRQGNGKAYDKILAARNKYGKGSAEE
FEEVSKAMSASAKSAGALNFTDPGKQGAITSLAHMRGPSGAQAILNSMESGKIVRADSLT
PSAITKIESMKPDDFQNSLLKARIAYDKAIYGNTITTQAGKQYNWWEHYGNGLQKRYARE
AQEFLKLSQE

Enzyme Prediction     

No EC number prediction in MGYG000002520_01206.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3501	VgrG	0.0	5	544	16	549	Uncharacterized conserved protein, implicated in type VI secretion and phage assembly [Intracellular trafficking, secretion, and vesicular transport, Mobilome: prophages, transposons, General function prediction only].
TIGR03361	VI_Rhs_Vgr	0.0	4	519	2	513	type VI secretion system Vgr family protein. Members of this protein family belong to the Rhs element Vgr protein family (see TIGR01646), but furthermore all are found in genomes with type VI secretion loci. However, members of this protein family, although recognizably correlated to type VI secretion according the partial phylogenetic profiling algorithm, are often found far the type VI secretion locus.
TIGR01646	vgr_GE	1.27e-144	19	501	6	483	Rhs element Vgr protein. This model represents the Vgr family of proteins, associated with some classes of Rhs elements. This model does not include a large octapeptide repeat region, VGXXXXXX, found in the Vgr of Rhs classes G and E.
pfam05954	Phage_GPD	4.34e-98	22	327	1	304	Phage late control gene D protein (GPD). This family includes a number of phage late control gene D proteins and related bacterial sequences. This family also includes Bacteriophage Mu P proteins and related sequences.
pfam04717	Phage_base_V	1.57e-12	381	449	11	75	Type VI secretion system, phage-baseplate injector. Family of bacterial and phage baseplate assembly proteins responsible for forming the small spike at the end of the tail or bacterial pathogenic needle-shaft.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AHW93947.1	0.0	1	658	1	660
QEI71926.1	0.0	1	662	1	661
QFH36231.1	0.0	1	662	1	661
QPD69224.1	0.0	1	662	1	661
AKZ84597.1	0.0	1	662	1	661

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4MTK_A	3.13e-153	5	642	7	643	Crystalstructure of PA0091 VgrG1, the central spike of the Type VI Secretion System [Pseudomonas aeruginosa PAO1],4MTK_B Crystal structure of PA0091 VgrG1, the central spike of the Type VI Secretion System [Pseudomonas aeruginosa PAO1],4MTK_C Crystal structure of PA0091 VgrG1, the central spike of the Type VI Secretion System [Pseudomonas aeruginosa PAO1],4MTK_D Crystal structure of PA0091 VgrG1, the central spike of the Type VI Secretion System [Pseudomonas aeruginosa PAO1],4MTK_E Crystal structure of PA0091 VgrG1, the central spike of the Type VI Secretion System [Pseudomonas aeruginosa PAO1],4MTK_F Crystal structure of PA0091 VgrG1, the central spike of the Type VI Secretion System [Pseudomonas aeruginosa PAO1],6H3L_A Structure of VgrG1 in the Type VI secretion 'pre-firing' VgrG1-Tse6-EagT6-EF-Tu-Tsi6 complex [Pseudomonas aeruginosa PAO1],6H3L_B Structure of VgrG1 in the Type VI secretion 'pre-firing' VgrG1-Tse6-EagT6-EF-Tu-Tsi6 complex [Pseudomonas aeruginosa PAO1],6H3L_C Structure of VgrG1 in the Type VI secretion 'pre-firing' VgrG1-Tse6-EagT6-EF-Tu-Tsi6 complex [Pseudomonas aeruginosa PAO1],6H3N_A Structure of VgrG1 in the Type VI secretion VgrG1-Tse6-EF-Tu complex embedded in lipid nanodiscs [Pseudomonas aeruginosa PAO1],6H3N_B Structure of VgrG1 in the Type VI secretion VgrG1-Tse6-EF-Tu complex embedded in lipid nanodiscs [Pseudomonas aeruginosa PAO1],6H3N_C Structure of VgrG1 in the Type VI secretion VgrG1-Tse6-EF-Tu complex embedded in lipid nanodiscs [Pseudomonas aeruginosa PAO1]
4UHV_A	2.71e-150	5	642	7	643	Thestructure of VgrG1, the needle tip of the bacterial Type VI Secretion System [Pseudomonas aeruginosa PAO1],4UHV_B The structure of VgrG1, the needle tip of the bacterial Type VI Secretion System [Pseudomonas aeruginosa PAO1]
7Q5P_A	3.86e-148	2	640	9	644	ChainA, Type VI secretion protein VgrG [Pseudomonas protegens Pf-5],7Q5P_B Chain B, Type VI secretion protein VgrG [Pseudomonas protegens Pf-5],7Q5P_C Chain C, Type VI secretion protein VgrG [Pseudomonas protegens Pf-5]
2P5Z_X	1.26e-28	21	452	35	474	TheE. coli c3393 protein is a component of the type VI secretion system and exhibits structural similarity to T4 bacteriophage tail proteins gp27 and gp5 [Escherichia coli O6]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9I741	1.71e-152	5	642	7	643	Type VI secretion system spike protein VgrG1a OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=vgrG1a PE=1 SV=1
Q9I0F3	1.76e-129	18	519	62	561	Type VI secretion system spike protein VgrG1c OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=vgrG1c PE=1 SV=1
Q9I737	8.49e-127	2	519	9	524	Type VI secretion system spike protein VgrG1b OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=vgrG1b PE=3 SV=1
Q9HYC3	7.58e-87	20	525	27	535	Type VI secretion system spike protein VgrG4b OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=vgrG4b PE=3 SV=1
E0SIS4	1.57e-80	23	522	30	522	Putative type VI secretion system protein VgrGB OS=Dickeya dadantii (strain 3937) OX=198628 GN=vgrGB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000069	0.000003	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002520_01206.