CAZyme Information: MGYG000002520_01935

Basic Information

• Species: Pluralibacter gergoviae
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Pluralibacter; Pluralibacter gergoviae
• CAZyme ID: MGYG000002520_01935
• CAZy Family: GH23
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
905	MGYG000002520_1|CGC28	94388.62	9.3675

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002520	5408082	Isolate	United States	North America

• Gene Location: Start: 2087726; End: 2090443 Strand: +

Full Sequence      

MAQMTERQVAYSRRLDEKYGFPSGTMETLVGNESSGNGNAESPKGARGYAQLMPSAMSDA
GYRGTDPRSLSFEKQMSIAASHLNRGMKRFGDIGMALAGYNSGNGRVNAVRNGKATLPAE
TADYVSKFANAGIIPDDSEVMQYAQAGKRRDIQQPDYSDLDKEISLVGDTSAWDAKRQQF
KNQEAGQPTASSWEQKRAQFLANEGAGEPQQQVAQSNLNPDMEYLSPGLKAAPEQAARGI
ANIPFDVMDAGVGVVNAAGEAAAWANGVLGVNNGEFHPLQQTYRPVDSPTDSYAQAGEAI
APYLIPGVGPERAAAVMASVANAPRAERAATQVAGMLAENLPGTLASSQRNGQISPEDFA
KESGIGLAGSLGARSLIKGGQAATGAVRNVMSGNANSAGPVSGAMNTLETANDVSKAARS
AAGRENISAQASSVSDDVARAAENTGVNVETLTPGMRSGSRGIAQAEGVLASTPGHVQDA
HLRAFNEISSKLNKQLSDFGAESGSASEKSAAIKDRISSTLDDMKDAENKSWADVRSTMP
RDRMKMSNGMAVVSGEKAAGVPLSPEMKQFQAANSQGGITFDGMKAWRAKFADAEQANIR
SGKANAARIAGEMRRAITDDMRSMAEKGNFLPEWQKANDLSKGYITAKKNAESVFGRDLA
SDTMVRKGVDMLKASADSGPGAFHRLISALPEAERQPAIASILQHAASQGEKGGVGEGAG
LQYFAKLMTPQNINAISRHAPDLGRIMKEFGVLAKAGTRPQRFVERTGRTTEALKTLDTG
LPKIVGVIMNGIQQSGAIAGGFGGGVIGSIGGLVAGGALRNAVAKIGATRSGRYAIEKAV
QEATKAVNAGASPAAIAAAEKRFLANKIAVKAIRDAVGAEDFARLARAGIVSTLSGLTDN
DRADD

Enzyme Prediction     

No EC number prediction in MGYG000002520_01935.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd00254	LT-like	1.90e-15	33	127	11	105	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
pfam01464	SLT	2.17e-12	17	108	6	100	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.
cd16894	MltD-like	4.30e-11	33	128	17	124	Membrane-bound lytic murein transglycosylase D and similar proteins. Lytic transglycosylases (LT) catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc). Membrane-bound lytic murein transglycosylase D protein (MltD) family members may have one or more small LysM domains, which may contribute to peptidoglycan binding. Unlike the similar "goose-type" lysozymes, LTs also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria, the LTs in bacteriophage lambda, as well as the eukaryotic "goose-type" lysozymes (goose egg-white lysozyme; GEWL).
cd13401	Slt70-like	8.37e-09	33	125	31	139	70kDa soluble lytic transglycosylase (Slt70) and similar proteins. Catalytic domain of the 70kda soluble lytic transglycosylase (LT)-like proteins, which also have an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.
cd16896	LT_Slt70-like	2.77e-07	33	127	29	139	uncharacterized lytic transglycosylase subfamily with similarity to Slt70. Uncharacterized lytic transglycosylase (LT) with a conserved sequence pattern suggesting similarity to the Slt70, a 70kda soluble lytic transglycosylase which also has an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AVR03008.1	0.0	1	905	1	905
AUV42573.1	0.0	1	900	2	895
AUY40520.1	0.0	1	899	2	901
AUV44747.1	0.0	1	899	1	900
QJC48066.1	0.0	1	899	2	901

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q01146	2.53e-12	208	383	45	234	Internal virion protein gp16 OS=Salmonella phage P22 OX=10754 GN=16 PE=1 SV=2
Q9T1R3	1.00e-08	235	309	84	147	Putative DNA transfer protein p35 OS=Acyrthosiphon pisum secondary endosymbiont phage 1 OX=2682836 GN=35 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000080	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
797	819