CAZyme Information: MGYG000002520_03708

Basic Information

• Species: Pluralibacter gergoviae
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Pluralibacter; Pluralibacter gergoviae
• CAZyme ID: MGYG000002520_03708
• CAZy Family: GH23
• CAZyme Description: Endo-type membrane-bound lytic murein transglycosylase A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
206	MGYG000002520_1|CGC47	22914.41	9.9096

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002520	5408082	Isolate	United States	North America

• Gene Location: Start: 4026357; End: 4026977 Strand: -

Full Sequence      

MKFRFLVILFVLLAGCSSKPKHDYRNPPYDPTIPVQRAMQWMPISEKAGAAWGVSPRFIT
AIIAVESGGNPNAVSKSNAVGLMQLKASTAGREVYRYMGWRGQPSTSELKNPERNISMGA
AYFSILEHGPLAGIEDPQVMQYALVVSYVNGAGALLRTFSSDRKKAIREINGLDKEEFFD
YIVKNHPSSQAPRYIWKVQKAMDAID

Enzyme Prediction     

No EC number prediction in MGYG000002520_03708.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	40	203	1.8e-17	0.8740740740740741

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK15470	emtA	3.18e-143	1	205	1	203	membrane-bound lytic murein transglycosylase EmtA.
cd16893	LT_MltC_MltE	3.58e-80	43	202	1	161	membrane-bound lytic murein transglycosylases MltC and MltE, and similar proteins. MltC and MltE are periplasmic, outer membrane attached lytic transglycosylases (LTs), which cleave beta-1,4-glycosidic bonds joining N-acetylmuramic acid and N-acetylglucosamine in the cell wall peptidoglycan, yielding 1,6-anhydromuropeptides. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda
PRK11671	mltC	1.03e-54	36	201	187	352	membrane-bound lytic murein transglycosylase MltC.
pfam01464	SLT	1.70e-30	47	170	3	114	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.
COG0741	MltE	2.90e-27	37	203	135	296	Soluble lytic murein transglycosylase and related regulatory proteins (some contain LysM/invasin domains) [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AVR04644.1	4.55e-150	1	206	1	206
AIR01092.1	7.55e-149	1	206	1	206
ALR77022.1	1.39e-130	1	206	1	204
ADO48258.1	1.39e-130	1	206	1	204
QKN81522.1	4.27e-130	1	206	1	206

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3T36_A	5.80e-108	14	205	12	203	Crystalstructure of lytic transglycosylase MltE from Eschericha coli [Escherichia coli K-12],3T36_B Crystal structure of lytic transglycosylase MltE from Eschericha coli [Escherichia coli K-12],3T36_C Crystal structure of lytic transglycosylase MltE from Eschericha coli [Escherichia coli K-12],3T36_D Crystal structure of lytic transglycosylase MltE from Eschericha coli [Escherichia coli K-12],3T36_E Crystal structure of lytic transglycosylase MltE from Eschericha coli [Escherichia coli K-12],4HJV_A Crystal structure of E. coli MltE with bound bulgecin and murodipeptide [Escherichia coli K-12],4HJV_B Crystal structure of E. coli MltE with bound bulgecin and murodipeptide [Escherichia coli K-12],4HJV_C Crystal structure of E. coli MltE with bound bulgecin and murodipeptide [Escherichia coli K-12],4HJV_D Crystal structure of E. coli MltE with bound bulgecin and murodipeptide [Escherichia coli K-12],4HJV_E Crystal structure of E. coli MltE with bound bulgecin and murodipeptide [Escherichia coli K-12]
2Y8P_A	2.01e-106	21	205	2	186	CrystalStructure of an Outer Membrane-Anchored Endolytic Peptidoglycan Lytic Transglycosylase (MltE) from Escherichia coli [Escherichia coli K-12],2Y8P_B Crystal Structure of an Outer Membrane-Anchored Endolytic Peptidoglycan Lytic Transglycosylase (MltE) from Escherichia coli [Escherichia coli K-12]
6GHY_A	5.76e-106	21	205	2	186	Structureof Lytic Transglycosylase MltE inactive mutant E64Q from E.coli [Escherichia coli K-12],6GHY_B Structure of Lytic Transglycosylase MltE inactive mutant E64Q from E.coli [Escherichia coli K-12]
6GI3_B	5.76e-106	21	205	2	186	Structureof Lytic Transglycosylase MltE mutant S73A from E.coli [Escherichia coli]
6GI4_B	5.76e-106	21	205	2	186	Structureof Lytic Transglycosylase MltE mutant S75A from E.coli [Escherichia coli]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A4WBE8	2.16e-121	1	205	1	203	Endo-type membrane-bound lytic murein transglycosylase A OS=Enterobacter sp. (strain 638) OX=399742 GN=emtA PE=3 SV=1
B5R901	3.99e-117	1	205	1	203	Endo-type membrane-bound lytic murein transglycosylase A OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) OX=550538 GN=emtA PE=3 SV=1
Q8XGT6	3.99e-117	1	205	1	203	Endo-type membrane-bound lytic murein transglycosylase A OS=Salmonella typhi OX=90370 GN=emtA PE=3 SV=1
C0Q334	3.99e-117	1	205	1	203	Endo-type membrane-bound lytic murein transglycosylase A OS=Salmonella paratyphi C (strain RKS4594) OX=476213 GN=emtA PE=3 SV=1
Q57NL3	3.99e-117	1	205	1	203	Endo-type membrane-bound lytic murein transglycosylase A OS=Salmonella choleraesuis (strain SC-B67) OX=321314 GN=emtA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000000	1.000050	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002520_03708.