CAZyme Information: MGYG000002521_03137

Basic Information

• Species: Phytobacter ursingii
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Phytobacter; Phytobacter ursingii
• CAZyme ID: MGYG000002521_03137
• CAZy Family: GH23
• CAZyme Description: Endo-type membrane-bound lytic murein transglycosylase A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
224	MGYG000002521_5|CGC32	24806.77	10.1168

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002521	6166452	Isolate	United States	North America

• Gene Location: Start: 2503439; End: 2504113 Strand: -

Full Sequence      

MPLTLFVVIRSDAFTKEGLRVKLRWFAFLIVLLAGCTSKRTDYRNPDWNPEVPVKRAMQW
MPVSEKAGAAWGVSPRLITAMIAVESGGNPNLISKSNAVGLMQLKASTSGREVYRYMGWS
GEPSTSELKNPERNISMGAAYLSIMEHGVLAGIKDPQVMQYALVVSYVNGAGALLRTFSS
DRKKAIDKINDLSADGFFEHVVENHPAPQAPRYIWKVQKAMNAM

Enzyme Prediction     

No EC number prediction in MGYG000002521_03137.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	59	222	2.2e-16	0.8740740740740741

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK15470	emtA	6.17e-151	21	224	1	203	membrane-bound lytic murein transglycosylase EmtA.
cd16893	LT_MltC_MltE	3.49e-78	65	222	4	162	membrane-bound lytic murein transglycosylases MltC and MltE, and similar proteins. MltC and MltE are periplasmic, outer membrane attached lytic transglycosylases (LTs), which cleave beta-1,4-glycosidic bonds joining N-acetylmuramic acid and N-acetylglucosamine in the cell wall peptidoglycan, yielding 1,6-anhydromuropeptides. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda
PRK11671	mltC	1.13e-52	55	220	187	352	membrane-bound lytic murein transglycosylase MltC.
COG0741	MltE	1.20e-27	19	220	91	294	Soluble lytic murein transglycosylase and related regulatory proteins (some contain LysM/invasin domains) [Cell wall/membrane/envelope biogenesis].
pfam01464	SLT	1.24e-27	66	189	3	114	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BBE78379.1	1.34e-160	1	224	1	224
AKL15318.1	4.19e-148	21	224	1	204
AUV04188.1	1.71e-147	21	224	1	204
QJF18265.1	6.94e-147	21	224	1	204
QOV70630.1	6.94e-147	21	224	1	204

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3T36_A	5.01e-109	38	224	17	203	Crystalstructure of lytic transglycosylase MltE from Eschericha coli [Escherichia coli K-12],3T36_B Crystal structure of lytic transglycosylase MltE from Eschericha coli [Escherichia coli K-12],3T36_C Crystal structure of lytic transglycosylase MltE from Eschericha coli [Escherichia coli K-12],3T36_D Crystal structure of lytic transglycosylase MltE from Eschericha coli [Escherichia coli K-12],3T36_E Crystal structure of lytic transglycosylase MltE from Eschericha coli [Escherichia coli K-12],4HJV_A Crystal structure of E. coli MltE with bound bulgecin and murodipeptide [Escherichia coli K-12],4HJV_B Crystal structure of E. coli MltE with bound bulgecin and murodipeptide [Escherichia coli K-12],4HJV_C Crystal structure of E. coli MltE with bound bulgecin and murodipeptide [Escherichia coli K-12],4HJV_D Crystal structure of E. coli MltE with bound bulgecin and murodipeptide [Escherichia coli K-12],4HJV_E Crystal structure of E. coli MltE with bound bulgecin and murodipeptide [Escherichia coli K-12]
4HJY_A	1.59e-108	38	224	20	206	2.4A Crystal structure of E. coli MltE-E64Q with bound chitopentaose [Escherichia coli K-12],4HJY_B 2.4 A Crystal structure of E. coli MltE-E64Q with bound chitopentaose [Escherichia coli K-12],4HJZ_A 1.9 A Crystal structure of E. coli MltE-E64Q with bound chitopentaose [Escherichia coli K-12],4HJZ_B 1.9 A Crystal structure of E. coli MltE-E64Q with bound chitopentaose [Escherichia coli K-12]
2Y8P_A	2.12e-108	42	224	4	186	CrystalStructure of an Outer Membrane-Anchored Endolytic Peptidoglycan Lytic Transglycosylase (MltE) from Escherichia coli [Escherichia coli K-12],2Y8P_B Crystal Structure of an Outer Membrane-Anchored Endolytic Peptidoglycan Lytic Transglycosylase (MltE) from Escherichia coli [Escherichia coli K-12]
6GHY_A	6.06e-108	42	224	4	186	Structureof Lytic Transglycosylase MltE inactive mutant E64Q from E.coli [Escherichia coli K-12],6GHY_B Structure of Lytic Transglycosylase MltE inactive mutant E64Q from E.coli [Escherichia coli K-12]
6GI3_B	6.06e-108	42	224	4	186	Structureof Lytic Transglycosylase MltE mutant S73A from E.coli [Escherichia coli]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A8AFS5	4.34e-128	21	224	1	203	Endo-type membrane-bound lytic murein transglycosylase A OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) OX=290338 GN=emtA PE=3 SV=1
Q57NL3	1.24e-127	21	224	1	203	Endo-type membrane-bound lytic murein transglycosylase A OS=Salmonella choleraesuis (strain SC-B67) OX=321314 GN=emtA PE=3 SV=1
B5R2X1	1.24e-127	21	224	1	203	Endo-type membrane-bound lytic murein transglycosylase A OS=Salmonella enteritidis PT4 (strain P125109) OX=550537 GN=emtA PE=3 SV=1
B5R901	1.24e-127	21	224	1	203	Endo-type membrane-bound lytic murein transglycosylase A OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) OX=550538 GN=emtA PE=3 SV=1
Q8XGT6	1.24e-127	21	224	1	203	Endo-type membrane-bound lytic murein transglycosylase A OS=Salmonella typhi OX=90370 GN=emtA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.004142	0.115471	0.880032	0.000294	0.000052	0.000027

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002521_03137.