CAZyme Information: MGYG000002521_05961

Basic Information

• Species: Phytobacter ursingii
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Phytobacter; Phytobacter ursingii
• CAZyme ID: MGYG000002521_05961
• CAZy Family: GT107
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
680	MGYG000002521_5|CGC71	76149.7	9.5002

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002521	6166452	Isolate	United States	North America

• Gene Location: Start: 5395487; End: 5397529 Strand: -

Full Sequence      

MERMKNILGIYSGGIWRIPHLDSFLPGEHLRLSPFKTIPEQVNAIVVWGQRPSARKPVAM
AQSAGLPVIRLEDGFIRSLGLGVQDCSPLSIVVDHFGIYYDASVPSALECLVKDKAGNQP
LAAEAQAMMRAIVDNDLSKYNQAPPFVAPDIMPEAVLVIDQTFGDMSVTKGNAGPESFQQ
MLKAAKQENPRAEIWVKVHPDVLCGKKTGYFSNLKSDSRVRVFAEDVSPQSLLRHMQKVY
VVTSQYGFEALLAGKPVVCFGQPWYAGWGLTDDRHPKASELAARRYPSTLSNLFTAAYLR
YCRYRHPVSGKPATLACVVDWLSLQRNHSLVRRGTLWAPGLSLWKTAILKPFLKTAENQV
RFAKQCPQASALIVWGTRGEKKWQAQADAQHIPLWRMEDGFIRSSGLGSDLLAPLSLVLD
KTGIYYDASRPSDLENLLNASNLSERQRERAQALQQQLVHNKVSKYNLGQDWHLPPGAAG
KKVILVPGQVEDDASILTGTLSVNTNRDLLRTVRERNPGAFIVFKPHPDVLVGNRKGQVV
AEDITRWADCQALDADIIQCIQLADELHTMTSLSGFEALMHGKRVFCYGIPFYAGWGLTQ
DEHQIPRRSRQLTLTDLVWQTLVAYPTYIHPQRMEPMQAEEAALWLSSAPRGEMKITKKN
TGRLIRQYRKLLMFYNVRFG

Enzyme Prediction     

No EC number prediction in MGYG000002521_05961.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT107	284	672	1.4e-145	0.7424812030075187
GT107	15	327	2.3e-103	0.5921052631578947

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3563	KpsC	0.0	4	677	1	669	Capsule polysaccharide export protein KpsC/LpsZ [Cell wall/membrane/envelope biogenesis].
cd16439	beta_Kdo_transferase_KpsC_2	1.39e-158	370	628	1	259	beta-3-deoxy-D-manno-oct-2-ulosonic acid (Kdo)-transferase KpsC, repeat 2. KpsC is a beta-3-deoxy-D-manno-oct-2-ulosonic acid (Kdo)-transferase. It is part of the ATP-binding cassette transporter dependent capsular polysaccharides (CPSs) synthesis pathway, one of two CPS synthesis pathways present in Escherichia coli. The poly-Kdo linker is thought to be the common feature of CPSs synthesized via this pathway. CPSs are high-molecular-mass cell-surface polysaccharides that are important virulence factors for many pathogenic bacteria. KpsC contains a domain duplication.
cd16440	beta_Kdo_transferase_KpsC_1	1.31e-141	45	307	1	262	beta-3-deoxy-D-manno-oct-2-ulosonic acid (Kdo)-transferase KpsC, repeat1. KpsC is a beta-3-deoxy-D-manno-oct-2-ulosonic acid (Kdo)-transferase. It is part of the ATP-binding cassette transporter dependent capsular polysaccharides (CPSs) synthesis pathway, one of two CPS synthesis pathways present in Escherichia coli. The poly-Kdo linker is thought to be the common feature of CPSs synthesized via this pathway. CPSs are high-molecular-mass cell-surface polysaccharides that are important virulence factors for many pathogenic bacteria. KpsC contains a domain duplication.
cd16437	beta_Kdo_transferase_KpsC	3.96e-120	372	628	1	256	beta-3-deoxy-D-manno-oct-2-ulosonic acid (Kdo)-transferase KpsC. KpsC is a beta-3-deoxy-D-manno-oct-2-ulosonic acid (Kdo)-transferase. It is part of the ATP-binding cassette transporter dependent capsular polysaccharides (CPSs) synthesis pathway, one of two CPS synthesis pathways present in Escherichia coli. The poly-Kdo linker is thought to be the common feature of CPSs synthesized via this pathway. CPSs are high-molecular-mass cell-surface polysaccharides, that are important virulence factors for many pathogenic bacteria. KpsC contains a domain duplication.
cd16437	beta_Kdo_transferase_KpsC	1.95e-111	45	304	1	256	beta-3-deoxy-D-manno-oct-2-ulosonic acid (Kdo)-transferase KpsC. KpsC is a beta-3-deoxy-D-manno-oct-2-ulosonic acid (Kdo)-transferase. It is part of the ATP-binding cassette transporter dependent capsular polysaccharides (CPSs) synthesis pathway, one of two CPS synthesis pathways present in Escherichia coli. The poly-Kdo linker is thought to be the common feature of CPSs synthesized via this pathway. CPSs are high-molecular-mass cell-surface polysaccharides, that are important virulence factors for many pathogenic bacteria. KpsC contains a domain duplication.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AKL15456.1	0.0	7	680	1	674
AUV04097.1	0.0	7	680	1	674
QJF19767.1	0.0	7	680	1	674
AUU92844.1	0.0	7	680	1	674
AUV10486.1	0.0	7	680	1	674

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6MGC_A	3.30e-161	8	355	3	351	Escherichiacoli KpsC, N-terminal domain [Escherichia coli APEC O1]
6MGB_A	1.33e-77	8	322	11	321	Thermosulfurimonasdismutans KpsC, beta Kdo 2,4 transferase [Thermosulfurimonas dismutans]
6MGD_A	4.31e-71	342	642	10	314	Thermosulfurimonasdismutans KpsC, beta Kdo 2,7 transferase [Thermosulfurimonas dismutans],6MGD_B Thermosulfurimonas dismutans KpsC, beta Kdo 2,7 transferase [Thermosulfurimonas dismutans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P42217	0.0	7	680	1	675	Capsule polysaccharide export protein KpsC OS=Escherichia coli OX=562 GN=kpsC PE=4 SV=1
Q05013	3.34e-208	2	643	15	668	Capsule polysaccharide modification protein LipA OS=Neisseria meningitidis serogroup B (strain MC58) OX=122586 GN=lipA PE=4 SV=2
P57037	2.69e-207	2	643	15	668	Capsule polysaccharide modification protein LipA OS=Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491) OX=122587 GN=lipA PE=4 SV=1
P31858	4.02e-59	344	652	96	405	Lipopolysaccharide-processing protein LpsZ OS=Rhizobium meliloti OX=382 GN=lpsZ PE=4 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000050	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002521_05961.