CAZyme Information: MGYG000002522_02577

Basic Information

• Species: Lachnoanaerobaculum umeaense
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Lachnoanaerobaculum; Lachnoanaerobaculum umeaense
• CAZyme ID: MGYG000002522_02577
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1239	MGYG000002522_1|CGC22	143295.36	5.0522

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002522	2810441	Isolate	Sweden	Europe

• Gene Location: Start: 2748694; End: 2752413 Strand: -

Full Sequence      

MSLLELSKKYGKDEYSLLKENPSLENLSFFSSLSLGNTEWIDIKGKTLFLGSQIAILDDL
CNKSKVYIYEDDAERLGSVQAVFDIDIEYISDFDSINLNEFDTVIAYGSEKVSKLIRKEK
PNTKLVLIFDNKYGMNYFEEEFGDKEKEALSVKAVREWIGEHSTYYPYPNYRYVYKLFSD
KEMPGAGELSQIKAYDYPRFALKDIGERFSQAAKTGDFDSFANSYIIVAGGSEENVYIKY
NRTRLPKYQIKTEIRIKDDKKYVVKSALKRESIPHILGMYDGKKRIKNDSVTVLEGTFKN
AGEMNFPFVNGKSLSRLCEDYIEKDINGFIEGVKEYLKKIVDEDALNLDAIFDNFIFDGE
KFIAIDCEWIFDESMDFIKDRELFIKYRALHIFYQNNADKIQNNFSLTETDFMARFGIDD
IDGMDFIERSFQDYIHGDYQEVYLDNYFVETISHETLNEGLEALAELPHAKNKIIELSEI
NKDRELIVKELTRLRTLTDNHVNNLGIIIDNLRHENEELSKTLNVYNSNLSIPFRIRRKL
STIYNRKYPKGSVERKKLNYRLMSIFHPIKYFKLTHSEQGRNLIEGEFKIGDLYREKGKL
NFPYVENPKVSIIIPVYNQIHYTYACLVSLLENTQGYDYEIIIADDVSTDATKEIDNFVS
GLVIARNVTNQGFLKNCNNAAKKARGEYIFFLNNDTTVEKDWLSPLIKLLESDKGIGMVG
SKLIYPDGRLQEAGGIIWSDGSGWNYGRCDDPNKPEYNYVRDVDYISGAAIMLSRKLWED
IGGFDERYAPAYCEDSDLAFEVRKRGLRVVYQPLSVVVHFEGVSNGTDVNGTGLKRYQVE
NNKKLQEKWSEEFKNQYDNVGVPNGFRARERSMGKKVILFVDHYVPTFDKDAGSKTTFQY
IKMFIERGYVVKFLPDNFAKSEPYTGILEQMGVEVLYGNEMRTNIFEWIESNQANIDIAY
LNRPHIATKYIDFIKEKTDIKIIYYGHDLHFLRERREYELTGDVERKNASSYWKSMELDL
MRKASISYYPSNVEVDYIHTFDKKINAKAITAYVFEKFGNIDYNPDIREGVLFVGGFSHP
PNADALKYFLDNMWDEIYAQIKVPFYIVGSNATDEIKALHNEAKGIIFKGFVSEEELKEL
YEKVRLVVVPLRYGAGVKGKVIEALYYNDPVITTGVGAEGIDNSYNQMLVADEPGDFVNK
CVTLYNDKEALKNMSKAADDYVKNKHSIEAVWDIIREDF

Enzyme Prediction     

No EC number prediction in MGYG000002522_02577.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	611	729	3.6e-25	0.7176470588235294

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd04186	GT_2_like_c	1.03e-46	612	821	1	166	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
COG1216	GT2	7.77e-39	607	849	2	251	Glycosyltransferase, GT2 family [Carbohydrate transport and metabolism].
COG1215	BcsA	3.23e-26	594	825	40	269	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
pfam00535	Glycos_transf_2	4.72e-22	611	713	1	106	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.
cd02525	Succinoglycan_BP_ExoA	7.31e-21	609	820	1	208	ExoA is involved in the biosynthesis of succinoglycan. Succinoglycan Biosynthesis Protein ExoA catalyzes the formation of a beta-1,3 linkage of the second sugar (glucose) of the succinoglycan with the galactose on the lipid carrie. Succinoglycan is an acidic exopolysaccharide that is important for invasion of the nodules. Succinoglycan is a high-molecular-weight polymer composed of repeating octasaccharide units. These units are synthesized on membrane-bound isoprenoid lipid carriers, beginning with galactose followed by seven glucose molecules, and modified by the addition of acetate, succinate, and pyruvate. ExoA is a membrane protein with a transmembrance domain at c-terminus.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AYB00730.1	0.0	1	1239	1	1239
QUI96573.1	0.0	6	1239	11	1264
CBK78783.1	0.0	234	1239	3	1085
QIX92521.1	0.0	3	1239	8	1314
ASN93838.1	0.0	3	1239	8	1313

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6P61_A	9.11e-10	608	727	13	134	Structureof a Glycosyltransferase from Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) [Leptospira borgpetersenii serovar Hardjo-bovis str. JB197],6P61_B Structure of a Glycosyltransferase from Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) [Leptospira borgpetersenii serovar Hardjo-bovis str. JB197],6P61_C Structure of a Glycosyltransferase from Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) [Leptospira borgpetersenii serovar Hardjo-bovis str. JB197],6P61_D Structure of a Glycosyltransferase from Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) [Leptospira borgpetersenii serovar Hardjo-bovis str. JB197]
6S22_A	9.73e-08	608	854	183	446	Crystalstructure of the TgGalNAc-T3 in complex with UDP, manganese and FGF23c [Taeniopygia guttata],6S24_A Crystal structure of the TgGalNAc-T3 in complex with UDP, manganese and the peptide 3 [Taeniopygia guttata]
3BCV_A	4.05e-07	608	701	5	100	Crystalstructure of a putative glycosyltransferase from Bacteroides fragilis [Bacteroides fragilis NCTC 9343],3BCV_B Crystal structure of a putative glycosyltransferase from Bacteroides fragilis [Bacteroides fragilis NCTC 9343]
2Z86_A	1.49e-06	610	889	95	385	Crystalstructure of chondroitin polymerase from Escherichia coli strain K4 (K4CP) complexed with UDP-GlcUA and UDP [Escherichia coli],2Z86_B Crystal structure of chondroitin polymerase from Escherichia coli strain K4 (K4CP) complexed with UDP-GlcUA and UDP [Escherichia coli],2Z86_C Crystal structure of chondroitin polymerase from Escherichia coli strain K4 (K4CP) complexed with UDP-GlcUA and UDP [Escherichia coli],2Z86_D Crystal structure of chondroitin polymerase from Escherichia coli strain K4 (K4CP) complexed with UDP-GlcUA and UDP [Escherichia coli]
2Z87_A	1.49e-06	610	889	94	384	Crystalstructure of chondroitin polymerase from Escherichia coli strain K4 (K4CP) complexed with UDP-GalNAc and UDP [Escherichia coli],2Z87_B Crystal structure of chondroitin polymerase from Escherichia coli strain K4 (K4CP) complexed with UDP-GalNAc and UDP [Escherichia coli]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P55465	1.06e-19	602	826	619	852	Uncharacterized protein y4gI OS=Sinorhizobium fredii (strain NBRC 101917 / NGR234) OX=394 GN=NGR_a03550 PE=4 SV=1
Q50864	3.45e-18	599	828	565	801	O-antigen biosynthesis protein RfbC OS=Myxococcus xanthus OX=34 GN=rfbC PE=4 SV=1
E0U4V7	5.99e-08	609	703	2	102	Poly(ribitol-phosphate) beta-glucosyltransferase OS=Bacillus spizizenii (strain ATCC 23059 / NRRL B-14472 / W23) OX=655816 GN=tarQ PE=1 SV=1
O06483	2.62e-07	609	720	2	116	Uncharacterized glycosyltransferase YfnE OS=Bacillus subtilis (strain 168) OX=224308 GN=yfnE PE=3 SV=2
Q48214	4.79e-07	610	719	2	110	Uncharacterized glycosyltransferase HI_1696 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=HI_1696 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000091	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002522_02577.