CAZyme Information: MGYG000002523_01639

Basic Information

• Species: Christensenella minuta
• Lineage: Bacteria; Firmicutes_A; Clostridia_A; Christensenellales; Christensenellaceae; Christensenella; Christensenella minuta
• CAZyme ID: MGYG000002523_01639
• CAZy Family: GT4
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
718	MGYG000002523_7|CGC1	83460.19	5.5972

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002523	2940111	Isolate	Japan	Asia

• Gene Location: Start: 1731; End: 3887 Strand: -

Full Sequence      

MSEEKINSKEYWNERFDGDWDESAGRIQTKFFTYILLEGLSADIREDIFKSKYSIGDVSG
GTGDSLPILHEEFPESFLRGYDFSERAIAQARELYPKFDFKVADIFSAEYPEHVLICSNT
LEHFKNPWEAFDSLAKIEPKYIVILVPFLEAETMKTDNIVEEHVSYFDCENIQTERCGYK
LIQYRAVDTLGICWPGYQILLVYAPDDCSAEKVSLEKEVIDAQLRTPINLRMERMADLFR
EYNTCLYKTKLNFIYSQLHLDSERKHSAYLTTRVEELEKAKEKMAAAQNAMENHISNISN
SMGYKVLQRCYAFAERHKAVRAVGRKVKKILDGRRKKKQEKALLAYVESILDAYNGEYVF
LFQPLIEWHVPLFQRPQQIARSLGKAGVLYFYSTANMTDHIPIGEEVSKNCYVLNVGSSL
EKIARLITRKNKKLIYNIYSTDNWSSIDWIKSNQRWAYRTVYEYIDAISEEISGNAIPDA
TYQRHNYLIHAKDVLVVASADKLYQEVCEKVPAKKEVALVTNGVDIEHFTHLEARERAVP
REMEEIVAMGKPIIGYYGALATWTDTELITYVANQRPDYQYVLIGPRYHNRPEFDEVEKL
TNVYLLGTIHYNILPQYARWFDVATIPFMVNDISESTSPIKLFEYMALEKPIVTTDMPEC
EKYRSVMVAKSYEQYVEMLDRALARKNDPEYLALLRAEARENSWDHKAVEILEALRIR

Enzyme Prediction     

No EC number prediction in MGYG000002523_01639.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd04950	GT4_TuaH-like	2.27e-59	359	716	6	370	teichuronic acid biosynthesis glycosyltransferase TuaH and similar proteins. Members of this family may function in teichuronic acid biosynthesis/cell wall biogenesis. Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.
cd03801	GT4_PimA-like	2.88e-13	483	716	132	366	phosphatidyl-myo-inositol mannosyltransferase. This family is most closely related to the GT4 family of glycosyltransferases and named after PimA in Propionibacterium freudenreichii, which is involved in the biosynthesis of phosphatidyl-myo-inositol mannosides (PIM) which are early precursors in the biosynthesis of lipomannans (LM) and lipoarabinomannans (LAM), and catalyzes the addition of a mannosyl residue from GDP-D-mannose (GDP-Man) to the position 2 of the carrier lipid phosphatidyl-myo-inositol (PI) to generate a phosphatidyl-myo-inositol bearing an alpha-1,2-linked mannose residue (PIM1). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in certain bacteria and archaea.
cd03794	GT4_WbuB-like	1.56e-12	496	713	167	387	Escherichia coli WbuB and similar proteins. This family is most closely related to the GT1 family of glycosyltransferases. WbuB in E. coli is involved in the biosynthesis of the O26 O-antigen. It has been proposed to function as an N-acetyl-L-fucosamine (L-FucNAc) transferase.
pfam13649	Methyltransf_25	1.82e-08	57	131	3	85	Methyltransferase domain. This family appears to be a methyltransferase domain.
COG0438	RfaB	3.57e-08	399	716	51	375	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AYH39205.1	0.0	1	718	1	718
ACM19821.1	2.63e-93	347	716	67	427
AMN31646.1	2.03e-88	318	715	25	422
QUD73383.1	2.03e-88	318	715	25	422
SQG37551.1	2.03e-88	318	715	25	422

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O32267	1.92e-19	459	705	128	381	Putative teichuronic acid biosynthesis glycosyltransferase TuaH OS=Bacillus subtilis (strain 168) OX=224308 GN=tuaH PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000060	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002523_01639.