CAZyme Information: MGYG000002524_01664

Basic Information

• Species: Yersinia bercovieri
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Yersinia; Yersinia bercovieri
• CAZyme ID: MGYG000002524_01664
• CAZy Family: GT107
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
675	MGYG000002524_6|CGC1	74974.21	9.2175

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002524	4273500	Isolate	Finland	Europe

• Gene Location: Start: 67698; End: 69725 Strand: +

Full Sequence      

MIGIFSAGICRIEHLENFLAQPCCKLSSLRSIPPEVHSVAVWGHRPTGEKAVSLAHAAGL
PVIRLEDGFIRSLGLGVMGCPPLSMVVDTQGIYYDASRASSLETLIIDRAGNQPFYADAQ
SAMQLIVAADLSKYNLAPPFCGEPPQGDAVLVVDQTFGDMAVKYGNADAADFKAMLHAAL
DENPQAEIWLKIHPDVLQGKKAGYFTAIPHDPRIKLLAENVSPQSLLRHVSRVYVVTSQY
GFEALLAGKSVTVFGQPWYAGWGLTDDRHPQASALSARRGQATLQDLFSAAYFRYSRYID
PCSGQPATLFDVINGLLMQKNHQYQRQGQLWAPGLTLWKRSIFLLFLKTSLNRVSFREGK
TANTACVVWGSKGEQRWQEKALSQHLPVWRMEDGFLRSSGLGSDLNLPLSLVLDKSGIYY
DATRPSDLETLLNRSQLTALQSARAAEFRQRLVSSKVSKYNIGGTFRLPLTAQGKRILLV
PGQVEDDASILTGTVTIRTNSELLKTVRQRNPDAFIIYKPHPDVLVGNRQGDIPAADVAR
WADLQALDADIIQCIQVADELHTLTSLSGFEALLHGKRVFCYGLPFYAGWGLTQDEHRSP
RRNRILMLDDLVYQALIAYPTYVDPQRREAITAERALDILAAQPRARMQLSKKRAGRIIR
YYRKLIMLAKVTMNL

Enzyme Prediction     

No EC number prediction in MGYG000002524_01664.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT107	319	665	2.6e-132	0.6635338345864662
GT107	28	324	7.8e-102	0.5507518796992481

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3563	KpsC	0.0	4	665	6	670	Capsule polysaccharide export protein KpsC/LpsZ [Cell wall/membrane/envelope biogenesis].
cd16439	beta_Kdo_transferase_KpsC_2	1.01e-157	367	622	4	259	beta-3-deoxy-D-manno-oct-2-ulosonic acid (Kdo)-transferase KpsC, repeat 2. KpsC is a beta-3-deoxy-D-manno-oct-2-ulosonic acid (Kdo)-transferase. It is part of the ATP-binding cassette transporter dependent capsular polysaccharides (CPSs) synthesis pathway, one of two CPS synthesis pathways present in Escherichia coli. The poly-Kdo linker is thought to be the common feature of CPSs synthesized via this pathway. CPSs are high-molecular-mass cell-surface polysaccharides that are important virulence factors for many pathogenic bacteria. KpsC contains a domain duplication.
cd16440	beta_Kdo_transferase_KpsC_1	2.92e-144	39	301	1	262	beta-3-deoxy-D-manno-oct-2-ulosonic acid (Kdo)-transferase KpsC, repeat1. KpsC is a beta-3-deoxy-D-manno-oct-2-ulosonic acid (Kdo)-transferase. It is part of the ATP-binding cassette transporter dependent capsular polysaccharides (CPSs) synthesis pathway, one of two CPS synthesis pathways present in Escherichia coli. The poly-Kdo linker is thought to be the common feature of CPSs synthesized via this pathway. CPSs are high-molecular-mass cell-surface polysaccharides that are important virulence factors for many pathogenic bacteria. KpsC contains a domain duplication.
cd16437	beta_Kdo_transferase_KpsC	3.35e-122	366	622	1	256	beta-3-deoxy-D-manno-oct-2-ulosonic acid (Kdo)-transferase KpsC. KpsC is a beta-3-deoxy-D-manno-oct-2-ulosonic acid (Kdo)-transferase. It is part of the ATP-binding cassette transporter dependent capsular polysaccharides (CPSs) synthesis pathway, one of two CPS synthesis pathways present in Escherichia coli. The poly-Kdo linker is thought to be the common feature of CPSs synthesized via this pathway. CPSs are high-molecular-mass cell-surface polysaccharides, that are important virulence factors for many pathogenic bacteria. KpsC contains a domain duplication.
cd16437	beta_Kdo_transferase_KpsC	3.45e-113	39	298	1	256	beta-3-deoxy-D-manno-oct-2-ulosonic acid (Kdo)-transferase KpsC. KpsC is a beta-3-deoxy-D-manno-oct-2-ulosonic acid (Kdo)-transferase. It is part of the ATP-binding cassette transporter dependent capsular polysaccharides (CPSs) synthesis pathway, one of two CPS synthesis pathways present in Escherichia coli. The poly-Kdo linker is thought to be the common feature of CPSs synthesized via this pathway. CPSs are high-molecular-mass cell-surface polysaccharides, that are important virulence factors for many pathogenic bacteria. KpsC contains a domain duplication.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QDW32370.1	0.0	1	675	1	675
QKJ05815.1	0.0	1	675	1	675
QKJ04941.1	0.0	1	675	1	675
AJJ20900.1	0.0	1	675	1	675
AVL38069.1	0.0	1	675	1	675

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6MGC_A	4.53e-160	2	349	3	351	Escherichiacoli KpsC, N-terminal domain [Escherichia coli APEC O1]
6MGB_A	1.27e-76	2	317	11	322	Thermosulfurimonasdismutans KpsC, beta Kdo 2,4 transferase [Thermosulfurimonas dismutans]
6MGD_A	2.79e-71	336	637	10	315	Thermosulfurimonasdismutans KpsC, beta Kdo 2,7 transferase [Thermosulfurimonas dismutans],6MGD_B Thermosulfurimonas dismutans KpsC, beta Kdo 2,7 transferase [Thermosulfurimonas dismutans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P42217	0.0	1	671	1	672	Capsule polysaccharide export protein KpsC OS=Escherichia coli OX=562 GN=kpsC PE=4 SV=1
Q05013	3.94e-200	6	643	28	674	Capsule polysaccharide modification protein LipA OS=Neisseria meningitidis serogroup B (strain MC58) OX=122586 GN=lipA PE=4 SV=2
P57037	5.09e-198	6	643	28	674	Capsule polysaccharide modification protein LipA OS=Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491) OX=122587 GN=lipA PE=4 SV=1
P31858	9.95e-60	334	643	80	402	Lipopolysaccharide-processing protein LpsZ OS=Rhizobium meliloti OX=382 GN=lpsZ PE=4 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000029	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002524_01664.