CAZyme Information: MGYG000002525_02330

Basic Information

• Species: Yersinia intermedia
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Yersinia; Yersinia intermedia
• CAZyme ID: MGYG000002525_02330
• CAZy Family: GT2
• CAZyme Description: Glucans biosynthesis glucosyltransferase H

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
860		97372.06	8.5634

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002525	5023222	Isolate	Finland	Europe

• Gene Location: Start: 108552; End: 111134 Strand: +

Full Sequence      

MNKSNQSPVQDYIADLPLTAQQQGALRDALPEDVLLDSTPDAMPHLHQQLAASAPQEGVF
SQEDSALASVNARLRAAWPDALVRGKQLEPDCEGRTVISAMPPIKRTSMAPQAWRTNPVG
RFWDSLLGRSTVSRAQTHEQALAEKKWRSVGSLRRYILLILIVLQTTIATSYMKTILPYQ
GWALIDPFEIWQQNWQVSVMQLLPYLLQTGILILFAVLFCWVSAGFWTALMGFLQLLIGK
DKYSISSTIKGDEALNPAHRTALIMPICNEDVERVFAGLRATYESVAATGQLEHFDIYVL
SDSYDPDICVAEQKAWLELCRDVDGHGRIFYRRRRRRVKRKSGNIDDFCRRWGSQYSYMV
ILDADSVMSGECLTGLVRLMEANPNAGIIQSAPKASGMDTLYARIQQFATRVYGPLFTAG
LHYWQLGESHYWGHNAIIRVKPFIEHCALAPLPGEGSFAGSILSHDFVEAALMRRAGWGV
WIAYDLPGSYEELPPNLLDELKRDRRWCHGNLMNFRLFLVKGMHPVHRAVFLTGVMSYLS
APLWFMFLVLCTALQAVHTLMEPQYFLQPRQLFPVWPQWRPELAIGLFSTTLVLLFLPKL
LSIILIWAKGAKEYGGALRLLLSMLAEMLFSVLLAPVRMLFHTVFVVSAFLGWSVQWNSP
QRDDDATPWSEAMVRHGSQLLLGLVWAGGVAWLDLRFLWWLSPIVFSLILSPVVSVVSSR
RTLGMASKRAKLFLIPEEYNPPRELLATEEYLELNHQRALSNGFLHAVMNPSYNALASAM
ATARHHTRAIIEQVRAERLALALEAGPDKLAKLQRLELLSDPVLISRLHQQVWQQPEQYQ
IWNGYYRQLAHNMKAFPAAK

Enzyme Prediction     

No EC number prediction in MGYG000002525_02330.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	263	445	1.3e-23	0.9764705882352941

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG2943	MdoH	0.0	74	847	1	734	Membrane glycosyltransferase [Cell wall/membrane/envelope biogenesis, Carbohydrate transport and metabolism].
PRK05454	PRK05454	0.0	92	733	1	599	glucans biosynthesis glucosyltransferase MdoH.
cd04191	Glucan_BSP_MdoH	8.21e-154	261	514	1	254	Glucan_BSP_MdoH catalyzes the elongation of beta-1,2 polyglucose chains of glucan. Periplasmic Glucan Biosynthesis protein MdoH is a glucosyltransferase that catalyzes the elongation of beta-1,2 polyglucose chains of glucan, requiring a beta-glucoside as a primer and UDP-glucose as a substrate. Glucans are composed of 5 to 10 units of glucose forming a highly branched structure, where beta-1,2-linked glucose constitutes a linear backbone to which branches are attached by beta-1,6 linkages. In Escherichia coli, glucans are located in the periplasmic space, functioning as regulator of osmolarity. It is synthesized at a maximum when cells are grown in a medium with low osmolarity. It has been shown to span the cytoplasmic membrane.
pfam00535	Glycos_transf_2	8.40e-13	264	443	3	164	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.
pfam13632	Glyco_trans_2_3	6.16e-12	358	554	1	188	Glycosyl transferase family group 2. Members of this family of prokaryotic proteins include putative glucosyltransferases, which are involved in bacterial capsule biosynthesis.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ARB84721.1	0.0	1	860	1	860
AVL34505.1	0.0	1	860	1	860
QGR71721.1	0.0	1	860	1	860
VDZ53779.1	0.0	1	860	1	860
QGR66705.1	0.0	1	860	1	860

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q02EU0	0.0	4	847	6	831	Glucans biosynthesis glucosyltransferase H OS=Pseudomonas aeruginosa (strain UCBPP-PA14) OX=208963 GN=opgH PE=3 SV=1
Q82SA8	0.0	28	855	9	838	Glucans biosynthesis glucosyltransferase H OS=Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298) OX=228410 GN=opgH PE=3 SV=1
Q6D6A7	0.0	1	849	1	847	Glucans biosynthesis glucosyltransferase H OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) OX=218491 GN=mdoH PE=3 SV=1
Q1I3R6	0.0	1	833	1	818	Glucans biosynthesis glucosyltransferase H OS=Pseudomonas entomophila (strain L48) OX=384676 GN=opgH PE=3 SV=1
Q88D04	0.0	11	833	13	818	Glucans biosynthesis glucosyltransferase H OS=Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440) OX=160488 GN=opgH PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000055	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
156	178
211	233
535	557
585	607
620	642
697	719