CAZyme Information: MGYG000002526_01351

Basic Information

• Species: Aeromonas hydrophila
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Aeromonadaceae; Aeromonas; Aeromonas hydrophila
• CAZyme ID: MGYG000002526_01351
• CAZy Family: CBM50
• CAZyme Description: putative L,D-transpeptidase YcfS

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
305		33186.71	6.3537

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002526	5049466	Isolate	United States	North America

• Gene Location: Start: 1410669; End: 1411586 Strand: -

Full Sequence      

MFIARTLSLLALAASLLTAPVLATTYPLPPAGSRLIGELEDYIVQPDEHLELIGKHTQIG
FLALLEANPGVDPYLPKPGTRLTLPTQMLLPDVPREGIVINLPELRLYYFPKGKNEVMVL
PIGIGDIGRETPEMTTTVIAKNPNPTWVPGPMVRKSWLEQKGITLPTVVPPGPDNPLGKF
AMRLGYGKQDYLIHGTNKDFGVGLRVSAGCIRLRPDDIEALFKIVPIGTQVRVINQPVKT
AIEPDGRHWLEVHSPLSRTELELEQGAPLILSPEVEAFIAKPEVDGDKAASVLNSKNGIP
RPVSG

Enzyme Prediction     

No EC number prediction in MGYG000002526_01351.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK10260	PRK10260	2.01e-101	23	300	24	302	L,D-transpeptidase; Provisional
PRK10190	PRK10190	2.10e-99	21	304	19	303	L,D-transpeptidase; Provisional
COG1376	ErfK	1.79e-40	21	237	21	232	Lipoprotein-anchoring transpeptidase ErfK/SrfK [Cell wall/membrane/envelope biogenesis].
cd16913	YkuD_like	4.88e-39	98	234	2	121	L,D-transpeptidases/carboxypeptidases similar to Bacillus YkuD. Members of the YkuD-like family of proteins are found in a range of bacteria. The best studied member Bacillus YkuD has been shown to act as an L,D-transpeptidase that gives rise to an alternative pathway for peptidoglycan cross-linking. Another member Helicobacter pylori Csd6 functions as an L,D-carboxypeptidase and regulates helical cell shape and motility. The conserved region contains a conserved histidine and cysteine, with the cysteine thought to be an active site residue.
pfam17969	Ldt_C	3.92e-20	237	300	1	64	L,D-transpeptidase C-terminal domain. This is the C-terminal domain found in d-transpeptidases (Ldt) homologues from E.coli. Three of these enzymes (YbiS, ErfK, YcfS) have been shown to cross-link Braun's lipoprotein to the peptidoglycan (PG), while the other two (YnhG, YcbB) form direct meso-diaminopimelate (DAP-DAP, or 3-3) cross-links within the PG. Family members include erfK (ldtA), ybiS (ldtB), ycfS (ldtC), and ynhG (ldtE).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QLE84536.1	6.71e-108	22	304	18	299
QXC55304.1	2.40e-90	23	300	20	293
QUY00823.1	7.21e-87	23	300	20	293
QPC55488.1	7.21e-87	23	300	20	293
QTV10206.1	7.21e-87	23	300	20	293

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4LZH_A	4.03e-85	23	300	3	281	ChainA, L,D-transpeptidase [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]
6V45_A	1.49e-09	95	234	70	209	Crystalstructure of a Probable carnitine operon oxidoreductase caia from Brucella melitensis [Brucella melitensis bv. 1 str. 16M]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P75954	4.39e-95	13	300	18	307	Probable L,D-transpeptidase YcfS OS=Escherichia coli (strain K12) OX=83333 GN=ycfS PE=1 SV=1
P39176	1.92e-91	22	304	20	303	Probable L,D-transpeptidase ErfK/SrfK OS=Escherichia coli (strain K12) OX=83333 GN=erfK PE=1 SV=2
P40680	1.97e-88	22	304	20	303	Probable L,D-transpeptidase ErfK/SrfK OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=erfK PE=3 SV=1
P76193	7.01e-87	23	304	23	303	Probable L,D-transpeptidase YnhG OS=Escherichia coli (strain K12) OX=83333 GN=ynhG PE=1 SV=1
P0AAX8	4.31e-84	23	300	24	302	Probable L,D-transpeptidase YbiS OS=Escherichia coli (strain K12) OX=83333 GN=ybiS PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000206	0.999158	0.000156	0.000167	0.000151	0.000143

TMHMM  Annotations     

start	end
7	29