CAZyme Information: MGYG000002526_02124

Basic Information

• Species: Aeromonas hydrophila
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Aeromonadaceae; Aeromonas; Aeromonas hydrophila
• CAZyme ID: MGYG000002526_02124
• CAZy Family: GT51
• CAZyme Description: Monofunctional biosynthetic peptidoglycan transglycosylase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
260		29539.09	9.5298

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002526	5049466	Isolate	United States	North America

• Gene Location: Start: 2309252; End: 2310034 Strand: -

Full Sequence      

MAAPIIPDPDDPSHYVWEPEPEPDPVRPALARRLLSGLGKLLLAALLSTIVSVALLRFID
PPMWTWRLERALFPPAKVAEVKHDWVPLEQISRELQLAVIAAEDQRFAEHSGFDMDAISS
ALKHNQHSERVRGASTLSQQTAKNLFMWSDRSFLRKGIEAWFTLLMELGWDKSRILEMYL
NIVEFGPGIYGAEAAARHYFGKPAARLTRYEASLLAAALPNPWRYRVKPPSPYVQQRSAW
IRRQMGQLGQITLNKVHQAD

Enzyme Prediction     

EC	2.4.1.129

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT51	77	245	1.1e-56	0.9548022598870056

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00056	mtgA	7.27e-127	50	257	24	235	monofunctional biosynthetic peptidoglycan transglycosylase; Provisional
TIGR02070	mono_pep_trsgly	2.65e-89	50	249	19	222	monofunctional biosynthetic peptidoglycan transglycosylase. This family is one of the transglycosylases involved in the late stages of peptidoglycan biosynthesis. Members tend to be small, about 240 amino acids in length, and consist almost entirely of a domain described by pfam00912 for transglycosylases. Species with this protein will have several other transglycosylases as well. All species with this protein are Proteobacteria that produce murein (peptidoglycan). [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]
COG0744	MrcB	6.25e-75	80	259	73	254	Membrane carboxypeptidase (penicillin-binding protein) [Cell wall/membrane/envelope biogenesis].
pfam00912	Transgly	6.94e-71	76	245	6	176	Transglycosylase. The penicillin-binding proteins are bifunctional proteins consisting of transglycosylase and transpeptidase in the N- and C-terminus respectively. The transglycosylase domain catalyzes the polymerization of murein glycan chains.
TIGR02074	PBP_1a_fam	2.21e-49	85	252	4	172	penicillin-binding protein, 1A family. Bacterial that synthesize a cell wall of peptidoglycan (murein) generally have several transglycosylases and transpeptidases for the task. This family consists of bifunctional transglycosylase/transpeptidase penicillin-binding proteins (PBP). In the Proteobacteria, this family includes PBP 1A but not the paralogous PBP 1B (TIGR02071). This family also includes related proteins, often designated PBP 1A, from other bacterial lineages. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ANT67834.1	1.99e-189	1	260	1	260
QSR81458.1	5.69e-189	1	260	1	260
AKA17187.1	5.69e-189	1	260	1	260
APJ15599.1	5.69e-189	1	260	1	260
QSR77267.1	5.69e-189	1	260	1	260

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2OQO_A	1.39e-26	82	259	19	197	Crystalstructure of a peptidoglycan glycosyltransferase from a class A PBP: insight into bacterial cell wall synthesis [Aquifex aeolicus VF5],3D3H_A Crystal structure of a complex of the peptidoglycan glycosyltransferase domain from Aquifex aeolicus and neryl moenomycin A [Aquifex aeolicus],3NB7_A Crystal structure of Aquifex Aeolicus Peptidoglycan Glycosyltransferase in complex with Decarboxylated Neryl Moenomycin [Aquifex aeolicus]
3NB6_A	1.94e-26	82	259	19	197	Crystalstructure of Aquifex aeolicus peptidoglycan glycosyltransferase in complex with Methylphosphoryl Neryl Moenomycin [Aquifex aeolicus]
5ZZK_A	8.62e-22	80	259	54	240	ChainA, Monofunctional glycosyltransferase [Staphylococcus aureus subsp. aureus Mu50]
3HZS_A	1.10e-21	80	259	18	204	ChainA, Monofunctional glycosyltransferase [Staphylococcus aureus subsp. aureus MW2]
6FTB_A	1.13e-21	80	259	19	205	Staphylococcusaureus monofunctional glycosyltransferase in complex with moenomycin [Staphylococcus aureus MW2]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A0KK53	1.17e-167	26	260	1	235	Biosynthetic peptidoglycan transglycosylase OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049) OX=380703 GN=mtgA PE=3 SV=1
Q8EB02	2.44e-125	32	260	5	233	Biosynthetic peptidoglycan transglycosylase OS=Shewanella oneidensis (strain MR-1) OX=211586 GN=mtgA PE=3 SV=2
A1S3J2	3.65e-87	39	253	27	241	Biosynthetic peptidoglycan transglycosylase OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) OX=326297 GN=mtgA PE=3 SV=1
Q9I6B7	2.08e-73	30	249	1	222	Biosynthetic peptidoglycan transglycosylase OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=mtgA PE=3 SV=2
Q4K4C2	2.69e-73	30	249	1	222	Biosynthetic peptidoglycan transglycosylase OS=Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5) OX=220664 GN=mtgA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000012	0.000021	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
34	56