CAZyme Information: MGYG000002527_00638

Basic Information

• Species: Aeromonas caviae
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Aeromonadaceae; Aeromonas; Aeromonas caviae
• CAZyme ID: MGYG000002527_00638
• CAZy Family: GT32
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
231	MGYG000002527_5|CGC1	27024.94	7.4354

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002527	4477475	Isolate	Brazil	South America

• Gene Location: Start: 24913; End: 25608 Strand: -

Full Sequence      

MSATNRTIHAIWLGSRLPPLAHVCIDDWRKQGYSYKLWLDTDPQVKRWIQECTFARECYR
RGLLAFVTDYLRLKILAQEGGLYLDTDVTINQDPFPLFESVAFGVGYESDRLIGTAVIYA
RQDSAMLSELVRFYEQEIMSSPMYMGPEIMTHLVSEKLASSGDTALIAPVHYFYNYQGEA
IHFEPAAERYMTHWFQHSWKRSSGLVFLRAKAKGWSGYLYEWQKEFFRLRK

Enzyme Prediction     

No EC number prediction in MGYG000002527_00638.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3774	OCH1	5.18e-11	5	157	83	243	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
pfam12919	TcdA_TcdB	3.28e-05	54	100	160	208	TcdA/TcdB catalytic glycosyltransferase domain. This domain represents the N-terminal glycosyltransferase from a set of toxins found in some bacteria. This domain in TcdB glycosylates the host RhoA protein.
pfam12919	TcdA_TcdB	1.88e-04	6	179	1	163	TcdA/TcdB catalytic glycosyltransferase domain. This domain represents the N-terminal glycosyltransferase from a set of toxins found in some bacteria. This domain in TcdB glycosylates the host RhoA protein.
pfam04488	Gly_transf_sug	0.005	24	97	7	86	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ATP92129.1	2.15e-174	1	231	1	231
AUU22768.1	8.78e-174	1	231	1	231
AXB00722.1	8.78e-174	1	231	1	231
QUM01459.1	8.78e-174	1	231	1	231
QOK19408.1	8.78e-174	1	231	1	231

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000054	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002527_00638.