CAZyme Information: MGYG000002527_00639

Basic Information

• Species: Aeromonas caviae
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Aeromonadaceae; Aeromonas; Aeromonas caviae
• CAZyme ID: MGYG000002527_00639
• CAZy Family: GT25
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
243	MGYG000002527_5|CGC1	28083.33	8.0267

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002527	4477475	Isolate	Brazil	South America

• Gene Location: Start: 25605; End: 26336 Strand: -

Full Sequence      

MKIYVISLDRAVERRSRVESVLSARGIPFEFFSAVNGFEGLPERLQALPDDQHRIRFRSR
PLTPGEKGCYASHYLLWEKCVELDEPILILEDDFLPTQYFEEVVGTLPKIHEQYEYVKVE
PQIGTATALTTVDNMQLMFWHNNSCWTTGYSISPQGARRLLAHSQRWLCSVDNFIGESYR
TGLICTGLIPYAIYSPRDMGSDIQNQVVLKKVPLGFKLTRELYRFYRFVRMALWNMKQAG
GKA

Enzyme Prediction     

No EC number prediction in MGYG000002527_00639.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT25	2	175	1.8e-38	0.9834254143646409

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06532	Glyco_transf_25	2.63e-48	2	175	1	128	Glycosyltransferase family 25 [lipooligosaccharide (LOS) biosynthesis protein] is a family of glycosyltransferases involved in LOS biosynthesis. The members include the beta(1,4) galactosyltransferases: Lgt2 of Moraxella catarrhalis, LgtB and LgtE of Neisseria gonorrhoeae and Lic2A of Haemophilus influenzae. M. catarrhalis Lgt2 catalyzes the addition of galactose (Gal) to the growing chain of LOS on the cell surface. N. gonorrhoeae LgtB and LgtE link Gal-beta(1,4) to GlcNAc (N-acetylglucosamine) and Glc (glucose), respectively. The genes encoding LgtB and LgtE are two genes of a five gene locus involved in the synthesis of gonococcal LOS. LgtE is believed to perform the first step in LOS biosynthesis.
pfam01755	Glyco_transf_25	6.30e-41	2	175	3	200	Glycosyltransferase family 25 (LPS biosynthesis protein). Members of this family belong to Glycosyltransferase family 25 This is a family of glycosyltransferases involved in lipopolysaccharide (LPS) biosynthesis. These enzymes catalyze the transfer of various sugars onto the growing LPS chain during its biosynthesis.
COG3306	COG3306	4.03e-32	1	179	3	191	Glycosyltransferase involved in LPS biosynthesis, GR25 family [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ATP92130.1	6.68e-184	1	243	1	243
AXB00721.1	6.68e-184	1	243	1	243
BDA11538.1	6.68e-184	1	243	1	243
QDO77660.1	6.68e-184	1	243	1	243
AUV16775.1	6.68e-184	1	243	1	243

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q29NU5	1.70e-16	3	175	344	524	Glycosyltransferase 25 family member OS=Drosophila pseudoobscura pseudoobscura OX=46245 GN=GA16561 PE=3 SV=2
Q17FB8	3.08e-16	3	202	325	545	Glycosyltransferase 25 family member OS=Aedes aegypti OX=7159 GN=AAEL003481 PE=3 SV=1
Q57394	8.18e-16	4	173	5	175	Lipooligosaccharide biosynthesis protein lic2B OS=Haemophilus influenzae OX=727 GN=lic2B PE=3 SV=1
Q8IPK4	1.40e-15	2	175	334	515	Glycosyltransferase 25 family member OS=Drosophila melanogaster OX=7227 GN=CG31915 PE=2 SV=1
Q8IYK4	7.16e-14	2	179	343	530	Procollagen galactosyltransferase 2 OS=Homo sapiens OX=9606 GN=COLGALT2 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000072	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002527_00639.