CAZyme Information: MGYG000002527_00787

Basic Information

• Species: Aeromonas caviae
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Aeromonadaceae; Aeromonas; Aeromonas caviae
• CAZyme ID: MGYG000002527_00787
• CAZy Family: CBM13
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
158	MGYG000002527_8|CGC1	17201.67	5.179

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002527	4477475	Isolate	Brazil	South America

• Gene Location: Start: 72485; End: 72961 Strand: +

Full Sequence      

MAALLLGGCALQPKPEDLLMGAAPKPKAELEATLVTSGGFCVTLSEQGRLLTQPCDQQPN
QSFSWDVGALQLAGDCLVARGEDGLGMEVCREESHQWQWQGDRLFNRQVSLCLDVAGRRH
KPAVPLRLAECYGGANQSFEWTPSGTLLNRLMHPALAW

Enzyme Prediction     

No EC number prediction in MGYG000002527_00787.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
NF035930	lectin_2	3.92e-08	38	137	126	236	lectin. Lectins are important adhesin proteins, which bind carbohydrate structures on host cell surface. The carbohydrate specificity of diverse lectins to a large extent dictates bacteria tissue tropism by mediating specific attachment to unique host sites expressing the corresponding carbohydrate receptor.
smart00458	RICIN	5.32e-08	39	142	7	118	Ricin-type beta-trefoil. Carbohydrate-binding domain formed from presumed gene triplication.
cd00161	RICIN	1.45e-06	33	141	4	124	Ricin-type beta-trefoil; Carbohydrate-binding domain formed from presumed gene triplication. The domain is found in a variety of molecules serving diverse functions such as enzymatic activity, inhibitory toxicity and signal transduction. Highly specific ligand binding occurs on exposed surfaces of the compact domain sturcture.
NF035930	lectin_2	1.68e-04	98	147	116	163	lectin. Lectins are important adhesin proteins, which bind carbohydrate structures on host cell surface. The carbohydrate specificity of diverse lectins to a large extent dictates bacteria tissue tropism by mediating specific attachment to unique host sites expressing the corresponding carbohydrate receptor.
cd00161	RICIN	3.47e-04	68	150	1	91	Ricin-type beta-trefoil; Carbohydrate-binding domain formed from presumed gene triplication. The domain is found in a variety of molecules serving diverse functions such as enzymatic activity, inhibitory toxicity and signal transduction. Highly specific ligand binding occurs on exposed surfaces of the compact domain sturcture.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BBT51067.1	7.15e-119	1	158	1	158
ATP89065.1	1.17e-118	1	158	15	172
QLL86838.1	1.17e-118	1	158	15	172
BDA16143.1	1.17e-118	1	158	15	172
AUV16881.1	1.17e-118	1	158	15	172

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000002	0.000001	1.000045	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002527_00787.