CAZyme Information: MGYG000002527_01878

Basic Information

• Species: Aeromonas caviae
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Aeromonadaceae; Aeromonas; Aeromonas caviae
• CAZyme ID: MGYG000002527_01878
• CAZy Family: GH23
• CAZyme Description: Membrane-bound lytic murein transglycosylase F

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
280	MGYG000002527_18|CGC2	30918.27	10.7698

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002527	4477475	Isolate	Brazil	South America

• Gene Location: Start: 320780; End: 321622 Strand: +

Full Sequence      

MKKRLWGWGLLILLATTSHADPFRQAPKAMSALRQGAAMEQGNPRQAIAHYCTAANLGNP
EAYYRIGRLLARGPQGIRNARSANAYLAMAMRLGNQQAARYYNERVGNAPLGTCGIGGGG
GAPWVRPSTPFDQERYLARQSQAKQKLAVMIRQAAQRHKVDPQLALAIAIAESNLNSTAV
SSKQAQGVMQLIPETQARFGVTRPFDAQQNIRGAMIYLKWLEKQFGPDWVRISAAYNAGE
QAVLRHGGVPPYQETQEYVQRVLYYSGQDPDKPARRSSPR

Enzyme Prediction     

No EC number prediction in MGYG000002527_01878.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	155	268	1.1e-26	0.8444444444444444

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd00254	LT-like	2.04e-30	162	265	1	109	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd16896	LT_Slt70-like	7.52e-29	151	265	8	143	uncharacterized lytic transglycosylase subfamily with similarity to Slt70. Uncharacterized lytic transglycosylase (LT) with a conserved sequence pattern suggesting similarity to the Slt70, a 70kda soluble lytic transglycosylase which also has an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd13401	Slt70-like	5.29e-26	151	265	10	145	70kDa soluble lytic transglycosylase (Slt70) and similar proteins. Catalytic domain of the 70kda soluble lytic transglycosylase (LT)-like proteins, which also have an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.
pfam01464	SLT	9.94e-22	151	245	1	101	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.
cd13403	MLTF-like	7.52e-21	151	239	1	95	membrane-bound lytic murein transglycosylase F (MLTF) and similar proteins. This subfamily includes membrane-bound lytic murein transglycosylase F (MltF, murein lyase F) that degrades murein glycan strands. It is responsible for catalyzing the release of 1,6-anhydromuropeptides from peptidoglycan. Lytic transglycosylase catalyzes the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc) as do goose-type lysozymes. However, in addition, it also makes a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ATP91506.1	2.16e-203	1	280	1	280
BBT67800.1	1.25e-202	1	280	1	280
QUM02379.1	5.09e-202	1	280	1	280
QSO22856.1	7.24e-202	1	280	1	280
BCR27854.1	7.24e-202	1	280	1	280

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6FBT_A	2.02e-07	148	266	451	589	ChainA, Lytic murein transglycosylase [Pseudomonas aeruginosa]
5OHU_A	2.05e-07	148	266	480	618	TheX-ray Structure of Lytic Transglycosylase Slt from Pseudomonas aeruginosa [Pseudomonas aeruginosa]
6FC4_A	4.82e-07	148	266	452	590	ChainA, Soluble lytic murein transglycosylase [Pseudomonas aeruginosa]
6FCQ_A	4.82e-07	148	266	451	589	ChainA, Soluble lytic murein transglycosylase [Pseudomonas aeruginosa],6FCR_A Chain A, Soluble lytic murein transglycosylase [Pseudomonas aeruginosa],6FCS_A Chain A, Soluble lytic murein transglycosylase [Pseudomonas aeruginosa],6FCU_A Chain A, Soluble lytic murein transglycosylase [Pseudomonas aeruginosa]
1QSA_A	4.86e-06	159	265	465	594	CrystalStructure Of The 70 Kda Soluble Lytic Transglycosylase Slt70 From Escherichia Coli At 1.65 Angstroms Resolution [Escherichia coli],1QTE_A Crystal Structure Of The 70 Kda Soluble Lytic Transglycosylase Slt70 From Escherichia Coli At 1.90 A Resolution In Complex With A 1,6- Anhydromurotripeptide [Escherichia coli]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O31608	8.34e-24	151	266	64	181	Putative murein lytic transglycosylase YjbJ OS=Bacillus subtilis (strain 168) OX=224308 GN=yjbJ PE=3 SV=1
O31976	7.97e-20	146	263	1421	1538	SPbeta prophage-derived uncharacterized transglycosylase YomI OS=Bacillus subtilis (strain 168) OX=224308 GN=yomI PE=3 SV=2
O64046	7.97e-20	146	263	1421	1538	Probable tape measure protein OS=Bacillus phage SPbeta OX=66797 GN=yomI PE=3 SV=1
A5UDW4	1.11e-06	150	245	192	305	Membrane-bound lytic murein transglycosylase C OS=Haemophilus influenzae (strain PittEE) OX=374930 GN=mltC PE=3 SV=1
Q65VT8	1.48e-06	150	263	192	318	Membrane-bound lytic murein transglycosylase C OS=Mannheimia succiniciproducens (strain MBEL55E) OX=221988 GN=mltC PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000720	0.998345	0.000272	0.000236	0.000217	0.000196

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002527_01878.