CAZyme Information: MGYG000002527_03445

Basic Information

• Species: Aeromonas caviae
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Aeromonadaceae; Aeromonas; Aeromonas caviae
• CAZyme ID: MGYG000002527_03445
• CAZy Family: GH84
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
367	MGYG000002527_26|CGC2	41280.26	6.4954

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002527	4477475	Isolate	Brazil	South America

• Gene Location: Start: 115584; End: 116687 Strand: -

Full Sequence      

MPYQTLLSGLYPPSPKLGLIEGFFGKGWSWEARARYAQWLPRHGYGFYLYAPKEDGYLRK
HWATPWPADQLEALCQLARQCRENGLAFGVGLSPMGAHHDYARQRPALLEKVRLIEEALK
PDILAILFDDMKGDTPDLAHWQLTIAHDIAAHTDAGRLLFCPSYYSTDPVLEKVFGAMPP
HYLQDLGQGLDRRIDVFWTGPKVCSTEYPAAHLKQAADWLHRKPFLWDNYPVNDGSKASS
FLHLRAFENRPAELADLVSGHAVNPMKQAALSALPLATLPMSYKLGKQYDPDKALHASLN
ATCGPQISAMIQADLPLFQDIGLAQLTPEQVIHLKSRYLPFQDQACVNEILRWLAGEYVF
DPDCLTD

Enzyme Prediction     

No EC number prediction in MGYG000002527_03445.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH84	18	309	3.9e-82	0.9694915254237289

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07555	NAGidase	6.47e-60	18	306	2	285	beta-N-acetylglucosaminidase. This family has previously been described as a hyaluronidase. However, more recently it has been shown that this family has beta-N-acetylglucosaminidase activity.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BBT65841.1	2.41e-287	1	367	1	367
AUY11195.1	3.42e-287	1	367	1	367
QQM77029.1	6.91e-287	1	367	1	367
SQH60437.1	6.91e-287	1	367	1	367
BCR29858.1	9.82e-287	1	367	1	367

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5DIY_A	1.92e-42	18	343	8	333	Thermobaculumterrenum O-GlcNAc hydrolase mutant - D120N [Thermobaculum terrenum],5DIY_B Thermobaculum terrenum O-GlcNAc hydrolase mutant - D120N [Thermobaculum terrenum]
2XSA_A	1.68e-38	18	301	4	290	ChainA, Hyaluronoglucosaminidase [Oceanicola granulosus HTCC2516],2XSB_A Chain A, Hyaluronoglucosaminidase [Oceanicola granulosus HTCC2516]
7KHS_A	1.73e-38	18	301	6	292	ChainA, Protein O-GlcNAcase [Oceanicola granulosus HTCC2516],7KHS_B Chain B, Protein O-GlcNAcase [Oceanicola granulosus HTCC2516],7KHS_C Chain C, Protein O-GlcNAcase [Oceanicola granulosus HTCC2516],7KHS_D Chain D, Protein O-GlcNAcase [Oceanicola granulosus HTCC2516]
5UHK_A	7.91e-26	18	284	8	278	Crystalstructure of the core catalytic domain of Human O-GlcNAcase [Homo sapiens],5UHK_C Crystal structure of the core catalytic domain of Human O-GlcNAcase [Homo sapiens],5UHL_A Crystal structure of the core catalytic domain of human O-GlcNAcase complexed with Thiamet G [Homo sapiens],5UHL_C Crystal structure of the core catalytic domain of human O-GlcNAcase complexed with Thiamet G [Homo sapiens],5UHO_A Crystal structure of the core catalytic domain of human O-GlcNAcase complexed with PUGNAc [Homo sapiens],5UHO_C Crystal structure of the core catalytic domain of human O-GlcNAcase complexed with PUGNAc [Homo sapiens]
5UHP_A	1.43e-25	18	284	51	321	Crystalstructure of the core catalytic domain of human O-GlcNAcase [Homo sapiens],5UHP_B Crystal structure of the core catalytic domain of human O-GlcNAcase [Homo sapiens],5UHP_C Crystal structure of the core catalytic domain of human O-GlcNAcase [Homo sapiens],5UHP_D Crystal structure of the core catalytic domain of human O-GlcNAcase [Homo sapiens],6PM9_A Crystal structure of the core catalytic domain of human O-GlcNAcase bound to MK-8719 [Homo sapiens],6PM9_B Crystal structure of the core catalytic domain of human O-GlcNAcase bound to MK-8719 [Homo sapiens],6PM9_C Crystal structure of the core catalytic domain of human O-GlcNAcase bound to MK-8719 [Homo sapiens],6PM9_D Crystal structure of the core catalytic domain of human O-GlcNAcase bound to MK-8719 [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q2CEE3	9.19e-38	18	301	4	290	Protein O-GlcNAcase OS=Oceanicola granulosus (strain ATCC BAA-861 / DSM 15982 / KCTC 12143 / HTCC2516) OX=314256 GN=OG2516_04129 PE=1 SV=1
O60502	4.44e-24	18	284	63	333	Protein O-GlcNAcase OS=Homo sapiens OX=9606 GN=OGA PE=1 SV=2
Q8VIJ5	4.44e-24	18	284	63	333	Protein O-GlcNAcase OS=Rattus norvegicus OX=10116 GN=Oga PE=1 SV=1
Q9EQQ9	4.44e-24	18	284	63	333	Protein O-GlcNAcase OS=Mus musculus OX=10090 GN=Oga PE=1 SV=2
Q89ZI2	1.80e-18	11	276	145	405	O-GlcNAcase BT_4395 OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50) OX=226186 GN=BT_4395 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000050	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002527_03445.