CAZyme Information: MGYG000002528_00885

Basic Information

• Species: Anaerostipes hadrus
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Anaerostipes; Anaerostipes hadrus
• CAZyme ID: MGYG000002528_00885
• CAZy Family: GT4
• CAZyme Description: Glycosyltransferase Gtf1

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
245	MGYG000002528_1|CGC10	28136.37	8.788

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002528	3172613	Isolate	China	Asia

• Gene Location: Start: 852211; End: 852948 Strand: -

Full Sequence      

MNINSASTEDEQKKANEYKKLRNYYIKMFQKIDLIHFNSSITKSIYEDYFELPENKVVTI
SHKNIRTRHKSVENKKSNKLRITCLAPARPFKGYNVLIKALDELWDSGKCNFMLKMFNTV
PDERKYLKVVENGFTQSDLPEIMSNTDVLVATSIWYETFGFTVLEALSFGIPVIVSDHVG
AKDIVGNAGIIVKAGDISELKNVIEALINDPDNLSKLKDNAKKKEVKTWKQFVDENYELY
HKLIG

Enzyme Prediction     

No EC number prediction in MGYG000002528_00885.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT4	74	213	2e-21	0.9375

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd03801	GT4_PimA-like	4.88e-31	1	241	110	366	phosphatidyl-myo-inositol mannosyltransferase. This family is most closely related to the GT4 family of glycosyltransferases and named after PimA in Propionibacterium freudenreichii, which is involved in the biosynthesis of phosphatidyl-myo-inositol mannosides (PIM) which are early precursors in the biosynthesis of lipomannans (LM) and lipoarabinomannans (LAM), and catalyzes the addition of a mannosyl residue from GDP-D-mannose (GDP-Man) to the position 2 of the carrier lipid phosphatidyl-myo-inositol (PI) to generate a phosphatidyl-myo-inositol bearing an alpha-1,2-linked mannose residue (PIM1). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in certain bacteria and archaea.
COG0438	RfaB	1.22e-24	18	245	137	379	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].
cd03823	GT4_ExpE7-like	1.59e-23	21	240	127	355	glycosyltransferase ExpE7 and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases. ExpE7 in Sinorhizobium meliloti has been shown to be involved in the biosynthesis of galactoglucans (exopolysaccharide II).
pfam00534	Glycos_transf_1	8.83e-22	78	224	1	158	Glycosyl transferases group 1. Mutations in this domain of PIGA lead to disease (Paroxysmal Nocturnal haemoglobinuria). Members of this family transfer activated sugars to a variety of substrates, including glycogen, Fructose-6-phosphate and lipopolysaccharides. Members of this family transfer UDP, ADP, GDP or CMP linked sugars. The eukaryotic glycogen synthases may be distant members of this family.
cd03825	GT4_WcaC-like	2.17e-19	50	243	156	364	putative colanic acid biosynthesis glycosyl transferase WcaC and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases. Escherichia coli WcaC has been predicted to function in colanic acid biosynthesis. WcfI in Bacteroides fragilis has been shown to be involved in the capsular polysaccharide biosynthesis.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AQP38887.1	1.82e-173	1	245	1	245
BCN32284.1	3.17e-77	15	240	222	446
CBK79341.1	1.69e-39	15	225	222	428
AVD55069.1	3.56e-38	14	242	235	469
CBL27169.1	6.28e-35	13	244	206	437

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3L01_A	9.98e-10	92	240	265	427	ChainA, GlgA glycogen synthase [Pyrococcus abyssi],3L01_B Chain B, GlgA glycogen synthase [Pyrococcus abyssi]
2BIS_A	1.01e-09	92	240	266	428	Structureof glycogen synthase from Pyrococcus abyssi [Pyrococcus abyssi],2BIS_B Structure of glycogen synthase from Pyrococcus abyssi [Pyrococcus abyssi],2BIS_C Structure of glycogen synthase from Pyrococcus abyssi [Pyrococcus abyssi]
2BFW_A	1.01e-09	92	224	50	195	Structureof the C domain of glycogen synthase from Pyrococcus abyssi [Pyrococcus abyssi]
3FRO_A	1.01e-09	92	240	265	427	Crystalstructure of Pyrococcus abyssi glycogen synthase with open and closed conformations [Pyrococcus abyssi],3FRO_B Crystal structure of Pyrococcus abyssi glycogen synthase with open and closed conformations [Pyrococcus abyssi],3FRO_C Crystal structure of Pyrococcus abyssi glycogen synthase with open and closed conformations [Pyrococcus abyssi]
4ZJ8_A	1.51e-09	92	231	300	452	Structuresof the human OX1 orexin receptor bound to selective and dual antagonists [Homo sapiens],4ZJC_A Structures of the human OX1 orexin receptor bound to selective and dual antagonists [Homo sapiens]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000092	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002528_00885.