CAZyme Information: MGYG000002529_01166

Basic Information

• Species: Aeromonas veronii
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Aeromonadaceae; Aeromonas; Aeromonas veronii
• CAZyme ID: MGYG000002529_01166
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
397	MGYG000002529_5|CGC3	44407.14	8.2946

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002529	4703176	Isolate	China	Asia

• Gene Location: Start: 168832; End: 170025 Strand: +

Full Sequence      

MEWIMIVFWLCAVLVVYHHVGYPLLLKFGGRQARKVASPPRPLDRGFKAEAADEALPTIT
LLMPVYNEAATIAAKLQNLASLDYPADKLWVHVHFDGCSDNSYPIALSQLGDPALQQLQI
RLFDHPRNRGKVAVLNEAMTRVHSDLVALTDVSALLPIDSLLLAVAHFADPKVGVVGEAY
RFWQPGSQGEESYWHYQSQIKLCESALGGMLGAHGAFYMMRRECLTPLAADTINDDFILP
MQAIAKGYRAVYDNRCAALELEVSDAALEATRRQRIGAGNTQQLLRLLPLLHPKFGWVAF
NFASGKGLRVLMPLCLTLLWLCAIPLATQSLLFQLLLGLQLLGYLLVILIQLTPVHPWPN
LFRKIHYLVLGHWYNGMGTLRYCLRAPIRFMSQEKAV

Enzyme Prediction     

No EC number prediction in MGYG000002529_01166.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	57	275	9.2e-16	0.9695652173913043

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06439	CESA_like_1	1.81e-100	18	283	1	251	CESA_like_1 is a member of the cellulose synthase (CESA) superfamily. This is a subfamily of cellulose synthase (CESA) superfamily. CESA superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members of the superfamily include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins.
COG1215	BcsA	1.23e-24	3	391	12	395	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
cd06423	CESA_like	3.69e-22	61	223	1	164	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.
cd06437	CESA_CaSu_A2	4.54e-14	57	275	1	225	Cellulose synthase catalytic subunit A2 (CESA2) is a catalytic subunit or a catalytic subunit substitute of the cellulose synthase complex. Cellulose synthase (CESA) catalyzes the polymerization reaction of cellulose using UDP-glucose as the substrate. Cellulose is an aggregate of unbranched polymers of beta-1,4-linked glucose residues, which is an abundant polysaccharide produced by plants and in varying degrees by several other organisms including algae, bacteria, fungi, and even some animals. Genomes from higher plants harbor multiple CESA genes. There are ten in Arabidopsis. At least three different CESA proteins are required to form a functional complex. In Arabidopsis, CESA1, 3 and 6 and CESA4, 7 and 8, are required for cellulose biosynthesis during primary and secondary cell wall formation. CESA2 is very closely related to CESA6 and is viewed as a prime substitute for CESA6. They functionally compensate each other. The cesa2 and cesa6 double mutant plants were significantly smaller, while the single mutant plants were almost normal.
pfam00535	Glycos_transf_2	1.65e-12	60	223	1	162	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AMQ42761.1	9.64e-291	1	397	1	397
QET78692.1	9.64e-291	1	397	1	397
QWL63018.1	1.37e-290	1	397	1	397
ANB69746.1	3.92e-290	1	397	1	397
ATY81271.1	5.57e-290	1	397	1	397

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6YV7_B	3.67e-18	19	251	13	237	MannosyltransferasePcManGT from Pyrobaculum calidifontis [Pyrobaculum calidifontis JCM 11548],6YV8_B Mannosyltransferase PcManGT from Pyrobaculum calidifontis in complex with GDP and Mn2+ [Pyrobaculum calidifontis JCM 11548],6YV9_A Mannosyltransferase PcManGT from Pyrobaculum calidifontis in complex with GDP-Man and Mn2+ [Pyrobaculum calidifontis JCM 11548]
6YV7_A	3.71e-18	19	251	14	238	MannosyltransferasePcManGT from Pyrobaculum calidifontis [Pyrobaculum calidifontis JCM 11548],6YV8_A Mannosyltransferase PcManGT from Pyrobaculum calidifontis in complex with GDP and Mn2+ [Pyrobaculum calidifontis JCM 11548],6YV9_B Mannosyltransferase PcManGT from Pyrobaculum calidifontis in complex with GDP-Man and Mn2+ [Pyrobaculum calidifontis JCM 11548]
5EJ1_A	2.94e-07	42	296	113	391	ChainA, Putative cellulose synthase [Cereibacter sphaeroides 2.4.1]
4HG6_A	3.03e-07	42	296	125	403	ChainA, Cellulose Synthase Subunit A [Cereibacter sphaeroides]
4P00_A	3.03e-07	42	296	126	404	ChainA, Cellulose Synthase A subunit [Cereibacter sphaeroides 2.4.1],4P02_A Chain A, Cellulose Synthase subunit A [Cereibacter sphaeroides 2.4.1],5EIY_A Chain A, Putative cellulose synthase [Cereibacter sphaeroides 2.4.1],5EJZ_A Chain A, Putative cellulose synthase [Cereibacter sphaeroides 2.4.1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P74165	2.68e-12	34	242	85	298	Beta-monoglucosyldiacylglycerol synthase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) OX=1111708 GN=sll1377 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000062	0.000002	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
4	26
310	332
336	358