CAZyme Information: MGYG000002529_01318

Basic Information

• Species: Aeromonas veronii
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Aeromonadaceae; Aeromonas; Aeromonas veronii
• CAZyme ID: MGYG000002529_01318
• CAZy Family: GH108
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
191		20660.75	7.1165

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002529	4703176	Isolate	China	Asia

• Gene Location: Start: 151167; End: 151742 Strand: +

Full Sequence      

MLSLALKWLLRPDVEGGEVNHPADRGGHTKYGIADAADGKKDGKADLDRDGVPDIAIGDL
TPAHTEPFYHQNYWAPARCDLIASLSPALSIAVFDAAVHHGPKRAIQLLQQVLGVMADGR
LGPVSIGRLKQQLGAKGECQLLLALMMQRASFMHGIVRKDPSQWANADGWINRLLRLQSY
LLSDVVGEVAA

Enzyme Prediction     

No EC number prediction in MGYG000002529_01318.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH108	14	101	3e-19	0.9069767441860465

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam05838	Glyco_hydro_108	4.55e-23	6	101	1	86	Glycosyl hydrolase 108. This family acts as a lysozyme (N-acetylmuramidase), EC:3.2.1.17. It contains a conserved EGGY motif near the N-terminus, the glutamic acid within this motif is essential for catalytic activity. In bacteria, it may activate the secretion of large proteins via the breaking and rearrangement of the peptidoglycan layer during secretion. It is frequently found at the N-terminus of proteins containing a C-terminal pfam09374 domain.
COG3926	ZliS	1.13e-22	15	191	16	178	Lysozyme family protein [General function prediction only].
cd13926	N-acetylmuramidase_GH108	2.03e-20	5	101	6	91	N-acetylmuramidase domain of the glycosyl hydrolase 108 family. This domain acts as a lysozyme (N-acetylmuramidase), EC:3.2.1.17. It contains a conserved EGGY motif near the N-terminus, the glutamic acid within this motif is essential for catalytic activity. In bacteria, it may activate the secretion of large proteins via the breaking and rearrangement of the peptidoglycan layer during secretion. It is frequently found at the N-terminus of proteins containing a peptidoglycan binding domain.
pfam09374	PG_binding_3	1.97e-05	104	174	1	75	Predicted Peptidoglycan domain. This family contains a potential peptidoglycan binding domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QWL79827.1	1.73e-133	1	191	1	191
QNF13671.1	1.73e-133	1	191	1	191
ATL91890.1	2.46e-133	1	191	1	191
QPR55160.1	7.05e-133	1	191	1	191
AEB49295.1	1.42e-132	1	191	1	191

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7DNP_A	8.93e-15	15	183	17	168	ChainA, Secretion activator protein, hypothetical [Brucella abortus bv. 1 str. 9-941]
6V3Z_A	2.36e-14	15	171	33	193	ChainA, Sen1395 [Salmonella enterica subsp. enterica serovar Enteritidis],6V3Z_B Chain B, Sen1395 [Salmonella enterica subsp. enterica serovar Enteritidis]
6V40_A	2.19e-10	15	177	31	197	ChainA, PG_binding_3 domain-containing protein [Salmonella enterica subsp. enterica serovar Typhi],6V40_B Chain B, PG_binding_3 domain-containing protein [Salmonella enterica subsp. enterica serovar Typhi],6V40_C Chain C, PG_binding_3 domain-containing protein [Salmonella enterica subsp. enterica serovar Typhi],6V40_D Chain D, PG_binding_3 domain-containing protein [Salmonella enterica subsp. enterica serovar Typhi]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.957196	0.042358	0.000238	0.000084	0.000049	0.000099

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002529_01318.