CAZyme Information: MGYG000002529_02674

Basic Information

• Species: Aeromonas veronii
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Aeromonadaceae; Aeromonas; Aeromonas veronii
• CAZyme ID: MGYG000002529_02674
• CAZy Family: CBM13
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
171	MGYG000002529_17|CGC1	18965.65	6.4322

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002529	4703176	Isolate	China	Asia

• Gene Location: Start: 72960; End: 73475 Strand: +

Full Sequence      

MNNKISFACSPALLAALLLGGCTIKPPSTDVMMGSIASQPQEEHARSPLLTSGDFCVAVS
QQKVLAQPCSGKDDQLFEWDLGELRLQELCLQAKNDSEVMLAPCDGQAQWEWQKDRLFNS
KVSRCLDVAGRRHTPGTPLRLAECYGGANQSFSWQRPNPWLETLKKQSLTW

Enzyme Prediction     

No EC number prediction in MGYG000002529_02674.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
NF035930	lectin_2	2.04e-12	69	150	147	236	lectin. Lectins are important adhesin proteins, which bind carbohydrate structures on host cell surface. The carbohydrate specificity of diverse lectins to a large extent dictates bacteria tissue tropism by mediating specific attachment to unique host sites expressing the corresponding carbohydrate receptor.
smart00458	RICIN	1.42e-09	54	155	7	118	Ricin-type beta-trefoil. Carbohydrate-binding domain formed from presumed gene triplication.
cd00161	RICIN	3.31e-09	67	154	27	124	Ricin-type beta-trefoil; Carbohydrate-binding domain formed from presumed gene triplication. The domain is found in a variety of molecules serving diverse functions such as enzymatic activity, inhibitory toxicity and signal transduction. Highly specific ligand binding occurs on exposed surfaces of the compact domain sturcture.
pfam00652	Ricin_B_lectin	1.25e-06	68	152	30	126	Ricin-type beta-trefoil lectin domain.
NF035930	lectin_2	4.35e-05	103	156	110	159	lectin. Lectins are important adhesin proteins, which bind carbohydrate structures on host cell surface. The carbohydrate specificity of diverse lectins to a large extent dictates bacteria tissue tropism by mediating specific attachment to unique host sites expressing the corresponding carbohydrate receptor.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AYK16513.1	3.10e-126	1	171	1	171
BBU02689.1	2.17e-117	1	171	1	170
QSR45886.1	2.17e-117	1	171	1	170
QPR53874.1	2.17e-117	1	171	1	170
BBR37503.1	6.22e-117	1	171	1	170

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000001	1.000049	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002529_02674.