CAZyme Information: MGYG000002530_01167

Basic Information

• Species: Ruminiclostridium_E siraeum
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Ruminococcaceae; Ruminiclostridium_E; Ruminiclostridium_E siraeum
• CAZyme ID: MGYG000002530_01167
• CAZy Family: GH26
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
362		43064.95	5.7776

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002530	2864211	Isolate	not provided	not provided

• Gene Location: Start: 1237785; End: 1238873 Strand: -

Full Sequence      

MAYTTDLNAELVSKQASKNTKMLFEYLKSIYGKKHLAGQQYLQSEEVEDLVYYHLTGKLP
AVRGYDFMGVSSCKKTDDQVDRAIKWATQCGGIVTMCWHWYAPNDMNDYSKGSSFYYKTT
SYDHKTCFDLCKGVTEGTAEYEFIIREIDMVSAELKRMAQLDIPVLWRPLHEANGNWFWW
GNHDEQHREAYKKLWYMIFDRMENYHKLTNLIWVWNGQDKCMEVSPDTFDICGDDIYSVK
EYDHSSQKQRFEYMTELAHGKMITLSECGYIPDPDEMKKDNAMWLWWLPWWGEFVYKREG
YKPVFDKDGYTVINEKYMTEDFMKRVMAHPDVIMREDLPWYDKDKHKLPDALSANLERIK
SK

Enzyme Prediction     

EC	3.2.1.78	3.2.1.100

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH26	12	336	1.2e-89	0.9933993399339934

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam02156	Glyco_hydro_26	3.21e-43	12	292	1	284	Glycosyl hydrolase family 26.
COG4124	ManB2	3.17e-12	163	307	180	340	Beta-mannanase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CBK96404.1	1.14e-287	1	362	1	362
CBL34792.1	7.73e-286	1	362	1	362
CBK96003.1	2.68e-95	12	354	92	437
CBL34396.1	5.34e-95	12	354	92	437
AIQ56350.1	6.58e-76	10	339	14	335

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6HPF_A	2.36e-52	12	338	7	310	Structureof Inactive E165Q mutant of fungal non-CBM carrying GH26 endo-b-mannanase from Yunnania penicillata in complex with alpha-62-61-di-galactosyl-mannotriose [Yunnania penicillata]
3ZM8_A	4.12e-49	6	295	140	421	ChainA, Gh26 Endo-beta-1,4-mannanase [Podospora anserina S mat+]
6HF2_A	2.94e-44	7	339	41	357	Thestructure of BoMan26B, a GH26 beta-mannanase from Bacteroides ovatus [Bacteroides ovatus ATCC 8483],6HF4_A The structure of BoMan26B, a GH26 beta-mannanase from Bacteroides ovatus, complexed with G1M4 [Bacteroides ovatus ATCC 8483]
3WDQ_A	9.56e-41	6	339	29	353	Crystalstructure of beta-mannanase from a symbiotic protist of the termite Reticulitermes speratus [Symbiotic protist of Reticulitermes speratus],3WDR_A Crystal structure of beta-mannanase from a symbiotic protist of the termite Reticulitermes speratus complexed with gluco-manno-oligosaccharide [Symbiotic protist of Reticulitermes speratus]
6Q75_A	4.70e-38	12	321	24	332	Thestructure of GH26A from Muricauda sp. MAR_2010_75 [Muricauda sp. MAR_2010_75],6Q75_B The structure of GH26A from Muricauda sp. MAR_2010_75 [Muricauda sp. MAR_2010_75]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P55297	2.14e-52	4	347	151	470	Mannan endo-1,4-beta-mannosidase B OS=Piromyces sp. OX=45796 GN=MANB PE=2 SV=1
P55296	1.38e-51	4	344	150	466	Mannan endo-1,4-beta-mannosidase A OS=Piromyces sp. OX=45796 GN=MANA PE=2 SV=1
P55298	2.10e-51	7	347	152	468	Mannan endo-1,4-beta-mannosidase C OS=Piromyces sp. OX=45796 GN=MANC PE=2 SV=1
G2Q4H7	2.50e-49	7	311	170	466	Mannan endo-1,4-beta-mannosidase OS=Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) OX=573729 GN=Man26A PE=1 SV=1
A2R6F5	6.26e-47	12	295	29	307	Mannan endo-1,4-beta-mannosidase man26A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=man26A PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000042	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002530_01167.