CAZyme Information: MGYG000002530_01863

Basic Information

• Species: Ruminiclostridium_E siraeum
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Ruminococcaceae; Ruminiclostridium_E; Ruminiclostridium_E siraeum
• CAZyme ID: MGYG000002530_01863
• CAZy Family: GT4
• CAZyme Description: Glycosyltransferase Gtf1

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
808	MGYG000002530_1|CGC24	93530.84	5.6553

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002530	2864211	Isolate	not provided	not provided

• Gene Location: Start: 2008190; End: 2010616 Strand: +

Full Sequence      

MSNPFTYANKVRKKFKDPYWVAKNKYITYYEQLPIDEKVILLESQTATKISGNLFYILKY
LLTDEKYAGYTVYLSSWGRYVKSITAILEHYGFENVNIVVYASDDYMRLLASAKYLINDA
TFPNYWIKKEGQVYINTWHGTPLKAMGRKVHNDVFFGNVQKNLVNADYLLYPNIFTKDVM
IRDYMLENISSNSYILCGYPRNTVFFDRDAEKKIREELEITDKKIYAYMPTWRGTVDKVG
VSKNDAYLMYYLCELDKRLTDDEIFYINIHPMAMHAKNTAEVSKLKHIKNFPAEYETYDF
LNIADVLVTDYSSVFFDYACTRKKVVLFPYDKDEYLCDRGMYMDMDDLPFPQVFDLDSLV
DELRSEKNYDDEEFVKTYCTWDSSNATAQLCDRTILGIDTGLTVAPVPNNSKENVLIYAG
NLDKNGITTSLRSLMKNIDLDKRNYYISFCQGKAKRHGEQLATFSDKVNFFAVAEYFNLT
AANKTVNKLYKEHLVSTNQYIKSLGKRIEQNFLRSYGNAKFDRVIQFCGYEDEMILLYSQ
FKGQKTIWVHNDMLAEIKTRSNQRKDLLEYAYHTYDNVVAVTDDIVAPTQILAGKDKKIN
IVKNTIDYKTILANSEQPIALDPTTKCSVEPEKFYEIMQSDAKKFINVGRYSPEKGHDRL
IDAFYKLWQKDNSIYLIIMGGNSRAKKYEELIEKVNEMGLSENVILLLSVSNPYPIIKAC
DGFILSSLYEGFGLVLAEADILGIPIVSTDITGPRTFMKKYGGTLIENSDEGVYKGLQML
YNGEIKPINVDYEAYNQECVAEFEKLFE

Enzyme Prediction     

No EC number prediction in MGYG000002530_01863.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT4	641	770	2.1e-27	0.80625

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam04464	Glyphos_transf	1.75e-60	34	393	1	357	CDP-Glycerol:Poly(glycerophosphate) glycerophosphotransferase. Wall-associated teichoic acids are a heterogeneous class of phosphate-rich polymers that are covalently linked to the cell wall peptidoglycan of gram-positive bacteria. They consist of a main chain of phosphodiester-linked polyols and/or sugar moieties attached to peptidoglycan via a linkage unit. CDP-glycerol:poly(glycerophosphate) glycerophosphotransferase is responsible for the polymerization of the main chain of the teichoic acid by sequential transfer of glycerol-phosphate units from CDP-glycerol to the linkage unit lipid.
cd03811	GT4_GT28_WabH-like	6.07e-48	414	800	1	345	family 4 and family 28 glycosyltransferases similar to Klebsiella WabH. This family is most closely related to the GT1 family of glycosyltransferases. WabH in Klebsiella pneumoniae has been shown to transfer a GlcNAc residue from UDP-GlcNAc onto the acceptor GalUA residue in the cellular outer core.
COG1887	TagB	7.49e-36	30	378	19	361	CDP-glycerol glycerophosphotransferase, TagB/SpsB family [Cell wall/membrane/envelope biogenesis, Lipid transport and metabolism].
pfam00534	Glycos_transf_1	2.47e-27	641	797	1	158	Glycosyl transferases group 1. Mutations in this domain of PIGA lead to disease (Paroxysmal Nocturnal haemoglobinuria). Members of this family transfer activated sugars to a variety of substrates, including glycogen, Fructose-6-phosphate and lipopolysaccharides. Members of this family transfer UDP, ADP, GDP or CMP linked sugars. The eukaryotic glycogen synthases may be distant members of this family.
pfam13692	Glyco_trans_1_4	8.65e-24	642	770	1	124	Glycosyl transferases group 1.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CBK97012.1	0.0	1	808	1	808
CBL33357.1	0.0	1	808	1	808
QBE99381.1	2.78e-217	10	806	4	800
QJU15211.1	4.55e-213	10	807	4	801
QQQ92281.1	5.49e-207	26	808	20	797

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3L7I_A	1.34e-29	23	392	334	712	Structureof the Wall Teichoic Acid Polymerase TagF [Staphylococcus epidermidis RP62A],3L7I_B Structure of the Wall Teichoic Acid Polymerase TagF [Staphylococcus epidermidis RP62A],3L7I_C Structure of the Wall Teichoic Acid Polymerase TagF [Staphylococcus epidermidis RP62A],3L7I_D Structure of the Wall Teichoic Acid Polymerase TagF [Staphylococcus epidermidis RP62A]
3L7J_A	9.60e-29	23	392	334	712	ChainA, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7J_B Chain B, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7J_C Chain C, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7J_D Chain D, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7K_A Chain A, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7K_B Chain B, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7K_C Chain C, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7K_D Chain D, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7L_A Chain A, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7L_B Chain B, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7L_C Chain C, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7L_D Chain D, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A]
3L7M_A	9.60e-29	23	392	334	712	ChainA, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7M_B Chain B, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7M_C Chain C, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7M_D Chain D, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A]
5D00_A	9.21e-11	565	770	137	326	Crystalstructure of BshA from B. subtilis complexed with N-acetylglucosaminyl-malate and UMP [Bacillus subtilis subsp. subtilis str. 168],5D00_B Crystal structure of BshA from B. subtilis complexed with N-acetylglucosaminyl-malate and UMP [Bacillus subtilis subsp. subtilis str. 168],5D01_A Crystal structure of BshA from B. subtilis complexed with N-acetylglucosaminyl-malate [Bacillus subtilis subsp. subtilis str. 168],5D01_B Crystal structure of BshA from B. subtilis complexed with N-acetylglucosaminyl-malate [Bacillus subtilis subsp. subtilis str. 168]
4X6L_A	1.72e-06	647	802	323	485	ChainA, TarM [Staphylococcus aureus subsp. aureus 21178],4X6L_B Chain B, TarM [Staphylococcus aureus subsp. aureus 21178],4X6L_C Chain C, TarM [Staphylococcus aureus subsp. aureus 21178],4X6L_D Chain D, TarM [Staphylococcus aureus subsp. aureus 21178],4X7P_A Chain A, TarM [Staphylococcus aureus subsp. aureus 21178],4X7P_B Chain B, TarM [Staphylococcus aureus subsp. aureus 21178]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q5HLM5	7.13e-29	23	392	334	712	Teichoic acid poly(glycerol phosphate) polymerase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) OX=176279 GN=tagF PE=1 SV=1
Q8RKI5	2.28e-28	33	378	27	372	Teichoic acid poly(glycerol phosphate) polymerase OS=Bacillus spizizenii (strain ATCC 23059 / NRRL B-14472 / W23) OX=655816 GN=tarF PE=1 SV=1
Q2G1C1	5.23e-24	95	391	75	384	Teichoic acid glycerol-phosphate transferase OS=Staphylococcus aureus (strain NCTC 8325 / PS 47) OX=93061 GN=tarF PE=1 SV=1
P13485	1.94e-21	32	364	376	706	Teichoic acid poly(glycerol phosphate) polymerase OS=Bacillus subtilis (strain 168) OX=224308 GN=tagF PE=1 SV=1
Q8RKJ2	2.16e-19	30	367	250	574	Teichoic acid poly(ribitol-phosphate) polymerase OS=Bacillus spizizenii (strain ATCC 23059 / NRRL B-14472 / W23) OX=655816 GN=tarL PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000047	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002530_01863.