CAZyme Information: MGYG000002531_00238

Basic Information

• Species: Pseudobutyrivibrio fibrisolvens_A
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Pseudobutyrivibrio; Pseudobutyrivibrio fibrisolvens_A
• CAZyme ID: MGYG000002531_00238
• CAZy Family: GT51
• CAZyme Description: Penicillin-binding protein 1A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
262		29071.89	8.6456

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002531	3116879	Isolate	not provided	not provided

• Gene Location: Start: 219525; End: 220313 Strand: +

Full Sequence      

MNYGKENAAKQSAKLAGRSKRKRHSAGLAIIRITLICIVSVIVASGVFAYLYAKNLIDQL
PDVSTIDISPTGYMSKVYDSDGNEIETLASTGANRTYVTLDQIPEDLQHAFVAIEDSRFY
EHNGIDPQGIIRAGVDGILSGFHFSQGASTLTQQLLKNNYFTTWTSEHTKMDSINRKIQE
QYLAVQLEKIVKKSVILENYLNSINLGQNTLGVQSAAERYFNKPVSELTLSESAVIASIT
QNPSKYNPITHPEENAKRRKNV

Enzyme Prediction     

No EC number prediction in MGYG000002531_00238.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT51	82	261	4.9e-61	0.9548022598870056

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00912	Transgly	5.10e-76	81	262	1	172	Transglycosylase. The penicillin-binding proteins are bifunctional proteins consisting of transglycosylase and transpeptidase in the N- and C-terminus respectively. The transglycosylase domain catalyzes the polymerization of murein glycan chains.
COG0744	MrcB	3.48e-73	12	262	2	236	Membrane carboxypeptidase (penicillin-binding protein) [Cell wall/membrane/envelope biogenesis].
TIGR02074	PBP_1a_fam	8.71e-69	94	262	1	161	penicillin-binding protein, 1A family. Bacterial that synthesize a cell wall of peptidoglycan (murein) generally have several transglycosylases and transpeptidases for the task. This family consists of bifunctional transglycosylase/transpeptidase penicillin-binding proteins (PBP). In the Proteobacteria, this family includes PBP 1A but not the paralogous PBP 1B (TIGR02071). This family also includes related proteins, often designated PBP 1A, from other bacterial lineages. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]
COG5009	MrcA	4.15e-68	30	262	8	226	Membrane carboxypeptidase/penicillin-binding protein [Cell wall/membrane/envelope biogenesis].
PRK11636	mrcA	5.65e-57	35	262	8	225	penicillin-binding protein 1a; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CBK73222.1	1.18e-182	1	262	1	262
AEN95629.1	2.95e-94	1	262	1	262
QUO33537.1	4.09e-94	1	262	1	263
CBL12211.1	8.86e-93	1	262	1	262
VCV20745.1	8.86e-93	1	262	1	262

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3NB6_A	1.33e-39	95	259	20	176	Crystalstructure of Aquifex aeolicus peptidoglycan glycosyltransferase in complex with Methylphosphoryl Neryl Moenomycin [Aquifex aeolicus]
2OQO_A	3.72e-39	95	259	20	176	Crystalstructure of a peptidoglycan glycosyltransferase from a class A PBP: insight into bacterial cell wall synthesis [Aquifex aeolicus VF5],3D3H_A Crystal structure of a complex of the peptidoglycan glycosyltransferase domain from Aquifex aeolicus and neryl moenomycin A [Aquifex aeolicus],3NB7_A Crystal structure of Aquifex Aeolicus Peptidoglycan Glycosyltransferase in complex with Decarboxylated Neryl Moenomycin [Aquifex aeolicus]
5U2G_A	8.30e-36	54	259	1	196	2.6Angstrom Resolution Crystal Structure of Penicillin-Binding Protein 1A from Haemophilus influenzae [Haemophilus influenzae Rd KW20],5U2G_B 2.6 Angstrom Resolution Crystal Structure of Penicillin-Binding Protein 1A from Haemophilus influenzae [Haemophilus influenzae Rd KW20]
7U4H_A	1.17e-33	75	247	21	182	ChainA, Penicillin-binding protein 1A (Pbp1a) [Chlamydia trachomatis D/UW-3/CX],7U4H_B Chain B, Penicillin-binding protein 1A (Pbp1a) [Chlamydia trachomatis D/UW-3/CX]
4OON_A	6.95e-33	76	259	22	195	Crystalstructure of PBP1a in complex with compound 17 ((4Z,8S,11E,14S)-5-(2-amino-1,3-thiazol-4-yl)-14-(5,6-dihydroxy-1,3-dioxo-1,3-dihydro-2H-isoindol-2-yl)-8-formyl-2-methyl-6-oxo-3,10-dioxa-4,7,11-triazatetradeca-4,11-diene-2,12,14-tricarboxylic acid) [Pseudomonas aeruginosa PAO1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P02918	1.38e-42	35	262	9	224	Penicillin-binding protein 1A OS=Escherichia coli (strain K12) OX=83333 GN=mrcA PE=1 SV=1
P38050	1.08e-38	75	262	49	226	Penicillin-binding protein 1F OS=Bacillus subtilis (strain 168) OX=224308 GN=pbpF PE=2 SV=2
O66874	1.14e-38	38	259	8	219	Penicillin-binding protein 1A OS=Aquifex aeolicus (strain VF5) OX=224324 GN=mrcA PE=1 SV=1
Q0SRL7	3.68e-38	52	250	49	242	Penicillin-binding protein 1A OS=Clostridium perfringens (strain SM101 / Type A) OX=289380 GN=pbpA PE=3 SV=1
Q8XJ01	6.11e-38	51	250	48	242	Penicillin-binding protein 1A OS=Clostridium perfringens (strain 13 / Type A) OX=195102 GN=pbpA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999254	0.000716	0.000005	0.000004	0.000001	0.000029

TMHMM  Annotations     

start	end
28	50