CAZyme Information: MGYG000002531_01589

Basic Information

• Species: Pseudobutyrivibrio fibrisolvens_A
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Pseudobutyrivibrio; Pseudobutyrivibrio fibrisolvens_A
• CAZyme ID: MGYG000002531_01589
• CAZy Family: CBM4
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
288		32017	4.2878

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002531	3116879	Isolate	not provided	not provided

• Gene Location: Start: 1540640; End: 1541506 Strand: -

Full Sequence      

MKNNRLKPLLAITLSSALAVSSIGCGASETPETREEPVAQETVEEPPAEPEEETVELGVN
LFTNGDFNSGTAPWDTYCFDGESFISQNKNSELDVAIFKLGSVDYGVQLFQDGFKLDEGC
KYKLAFDAYSDVERPIQVRFQLNGGDYHAYYQEEPVITTEKTHYEYDFTMSEPSDPAPRF
CINMGVMEGMDPNLAEHHICFDDFSLTLEDAKGKVSNNNTTEIPDIAVNQIGYLPSALKT
ATIKGTGLNQTAKLIDEKQANPFLKLKSAVEKIMQIQKIGKLFLILQR

Enzyme Prediction     

No EC number prediction in MGYG000002531_01589.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CBM4	60	185	3.2e-35	0.9920634920634921

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam02018	CBM_4_9	5.93e-07	59	171	1	118	Carbohydrate binding domain. This family includes diverse carbohydrate binding domains.
cd02850	E_set_Cellulase_N	6.32e-05	226	258	2	35	N-terminal Early set domain associated with the catalytic domain of cellulase. E or "early" set domains are associated with the catalytic domain of cellulases at the N-terminal end. Cellulases are O-glycosyl hydrolases (GHs) that hydrolyze beta 1-4 glucosidic bonds in cellulose. They are usually categorized into either exoglucanases, which sequentially release terminal sugar units from the cellulose chain, or endoglucanases, which also attack the chain internally. The N-terminal domain of cellulase may be related to the immunoglobulin and/or fibronectin type III superfamilies. These domains are associated with different types of catalytic domains at either the N-terminal or C-terminal end and may be involved in homodimeric/tetrameric/dodecameric interactions. Members of this family include members of the alpha amylase family, sialidase, galactose oxidase, cellulase, cellulose, hyaluronate lyase, chitobiase, and chitinase, among others.
pfam02927	CelD_N	3.84e-04	224	246	1	23	Cellulase N-terminal ig-like domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CBK74410.1	1.86e-208	1	288	1	288
ADX05680.1	2.20e-45	7	256	3	250
AEB15354.1	3.04e-37	60	258	37	238
CBK83282.1	2.23e-36	68	243	79	253
QWT52372.1	7.04e-33	5	256	3	271

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3K4Z_A	2.18e-08	60	243	15	205	ChainA, Glycoside hydrolase family 9 [Acetivibrio thermocellus JW20]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A3DCH1	4.23e-07	90	243	79	231	Cellulose 1,4-beta-cellobiosidase OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=celK PE=3 SV=1
P0C2S1	4.23e-07	90	243	79	231	Cellulose 1,4-beta-cellobiosidase OS=Acetivibrio thermocellus OX=1515 GN=celK PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000003	1.000039	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002531_01589.