CAZyme Information: MGYG000002531_02469

Basic Information

• Species: Pseudobutyrivibrio fibrisolvens_A
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Pseudobutyrivibrio; Pseudobutyrivibrio fibrisolvens_A
• CAZyme ID: MGYG000002531_02469
• CAZy Family: GT32
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
245	MGYG000002531_1|CGC31	28690.82	6.3884

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002531	3116879	Isolate	not provided	not provided

• Gene Location: Start: 2338518; End: 2339255 Strand: -

Full Sequence      

MRELKIPKKIHYFWFGGAAKPNSVLRCIDSWKKFCPDFEIIEWNENNYDIHKHPFMEKAF
NDKKWAFISDYARLDVLIQQGGIYLDTDVEVLKDLAPLCENQAFIGFENSQKVGDGQGFG
AVPDFPLFKEMLLDYDDLDEYIESPKLRTKVLLDHGLRLDGSRQNIEGIEIYPVEFFCPK
NWATGKITVTDNTYSIHHFDASWQDKKAHRYISLMRVLDRMLGEEKGKSTFDKIIFYKDK
VKGRQ

Enzyme Prediction     

No EC number prediction in MGYG000002531_02469.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	24	101	2.5e-24	0.9555555555555556

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3774	OCH1	9.83e-16	5	132	81	211	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
pfam04488	Gly_transf_sug	1.58e-15	21	98	1	86	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.
pfam05704	Caps_synth	2.18e-09	2	115	42	160	Capsular polysaccharide synthesis protein. This family consists of several capsular polysaccharide proteins. Capsular polysaccharide (CPS) is a major virulence factor in Streptococcus pneumoniae.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CBK75173.1	1.78e-189	1	245	1	245
AEZ62061.1	4.01e-74	6	234	2	239
CAD0171823.1	4.01e-74	6	234	2	239
QBR99983.1	1.14e-73	6	233	2	245
QBR99815.1	1.14e-73	6	233	2	245

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000029	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002531_02469.