CAZyme Information: MGYG000002531_03338

Basic Information

• Species: Pseudobutyrivibrio fibrisolvens_A
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Pseudobutyrivibrio; Pseudobutyrivibrio fibrisolvens_A
• CAZyme ID: MGYG000002531_03338
• CAZy Family: CBM67
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
204		22856.65	4.2996

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002531	3116879	Isolate	not provided	not provided

• Gene Location: Start: 3134219; End: 3134833 Strand: -

Full Sequence      

MEKIETARVYASACGLYEIYINGQKITDYVLTPGTANYKFEIPYQTYDVSNYVKTGENEI
HIILGDGWYRSTSGVDGDRNLFGEKTAVICQLEINGKAIVSTDNTWQASQNGPLRQNDMQ
HGEVYDARMEDLSDDEMAWHEVKEVPIGYELLKAMDTVPILRMERFDATIIKTPKGDTVL
DFGQNLAGQIELIIPNGAAGEKYA

Enzyme Prediction     

No EC number prediction in MGYG000002531_03338.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CBM67	3	130	1.4e-20	0.6818181818181818

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam08531	Bac_rhamnosid_N	6.14e-50	3	164	2	172	Alpha-L-rhamnosidase N-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. This domain is probably involved in substrate recognition.
pfam05592	Bac_rhamnosid	5.12e-04	171	202	1	31	Bacterial alpha-L-rhamnosidase concanavalin-like domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QFJ56391.1	7.27e-138	1	202	165	366
QQD65395.1	7.85e-62	1	194	174	362
QTE67956.1	2.65e-61	6	202	44	235
CBL02680.1	4.99e-56	5	202	168	360
AHF25957.1	6.44e-56	1	202	121	317

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6GSZ_A	1.25e-31	6	192	146	342	Crystalstructure of native alfa-L-rhamnosidase from Aspergillus terreus [Aspergillus terreus]
6I60_A	8.31e-27	2	202	187	388	Structureof alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12],6I60_B Structure of alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12]
3W5M_A	1.56e-26	2	200	314	520	CrystalStructure of Streptomyces avermitilis alpha-L-rhamnosidase [Streptomyces avermitilis MA-4680 = NBRC 14893],3W5N_A Crystal Structure of Streptomyces avermitilis alpha-L-rhamnosidase complexed with L-rhamnose [Streptomyces avermitilis MA-4680 = NBRC 14893]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q82PP4	8.54e-26	2	200	314	520	Alpha-L-rhamnosidase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) OX=227882 GN=SAVERM_828 PE=1 SV=1
T2KPL4	1.83e-24	2	192	195	398	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22170 PE=2 SV=1
T2KNB2	5.37e-21	4	195	187	388	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22090 PE=1 SV=2
P9WF03	6.19e-18	2	195	181	385	Alpha-L-rhamnosidase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_34 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000069	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002531_03338.