CAZyme Information: MGYG000002532_03632

Basic Information

• Species: Enterovibrio hollisae
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Vibrionaceae; Enterovibrio; Enterovibrio hollisae
• CAZyme ID: MGYG000002532_03632
• CAZy Family: GH63
• CAZyme Description: Glucosidase YgjK

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
755		85128.21	4.5733

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002532	4096279	Isolate	not provided	not provided

• Gene Location: Start: 3938081; End: 3940348 Strand: +

Full Sequence      

MSDQTFDKLILTDNESGDVIDLSLADANLYSTPDALVQELKTPTLLVTMTLRFATNRTSL
LETKLSDLSGQDRTFTAEWQGTLLTHAISTAPEKTVDEQYPEYGRRIEKSDLGLSISSNE
MKDNWAIRNDADATFVIARSVDTQTHIDGLSYKETAQLQLKHGQEQRLYTTFSYLHNAQE
VKEEASKIADILQNPNTYMEATKQRWTNYLTRGLTNTHASQEQARVGVKAMMTLNGNWRS
AAGDIEHDTVTPSVTARWFSGNLTWPWDTWKQAYALAHFNPDVAMENIRTVFQYQVQDND
PIRPQDKGYLLDVVTYTAPKSRGGAGAENWNERNTKPSLAAWAVMEIYHALRDEFNRPAD
AQAWIDEMYPKLVAYHDWWLTNRDHNGNGVPEYGAAVDPAHNTDDGQMYVEVVTKEDLAT
KFGNNATLIGNVNGENKYRVIGVDNYNRVLDEVIYSDLHVGAQEAAGWESGMDNAARFGF
IDEDQLQAYADKTYNGDLDRARKDWQVRFGENRDKETGKLLGFSMLQESVDQASYMYSDN
VYLADMAERVSAGVKGKDRAEEFRIGAEKIKTYINTCMFDEASGFYYDIRMVDQNGKDTA
YNKNGVMCAGQPLVERGRGPEGWGPLFNDAATQEHADSVIRTMTDPKEFATSEAFPGYGI
SLPTASQTNPAYGKDIYWRGRVWLDQFYFGVKAIEKYGYGPEAVQMAHQLFENAEGMTAD
GAIRENYNPETGAVQGASNFSWSAAHLYMLYRDFF

Enzyme Prediction     

No EC number prediction in MGYG000002532_03632.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH63	1	755	2.5e-195	0.8245614035087719

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK10137	PRK10137	0.0	1	755	94	784	alpha-glucosidase; Provisional
pfam03200	Glyco_hydro_63	9.88e-07	634	744	366	486	Glycosyl hydrolase family 63 C-terminal domain. This is a family of eukaryotic enzymes belonging to glycosyl hydrolase family 63. They catalyze the specific cleavage of the non-reducing terminal glucose residue from Glc(3)Man(9)GlcNAc(2). Mannosyl oligosaccharide glucosidase EC:3.2.1.106 is the first enzyme in the N-linked oligosaccharide processing pathway. This family represents the C-terminal catalytic domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AUW37824.1	0.0	1	755	99	853
AJR09240.1	0.0	1	755	101	856
QSV15127.1	0.0	1	755	99	853
BAJ03369.1	0.0	1	755	99	854
AGH80696.1	0.0	1	755	101	855

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3W7S_A	1.23e-250	6	755	71	757	Escherichiacoli K12 YgjK complexed with glucose [Escherichia coli K-12],3W7S_B Escherichia coli K12 YgjK complexed with glucose [Escherichia coli K-12],3W7T_A Escherichia coli K12 YgjK complexed with mannose [Escherichia coli K-12],3W7T_B Escherichia coli K12 YgjK complexed with mannose [Escherichia coli K-12],3W7U_A Escherichia coli K12 YgjK complexed with galactose [Escherichia coli K-12],3W7U_B Escherichia coli K12 YgjK complexed with galactose [Escherichia coli K-12]
3W7X_A	6.99e-250	6	755	71	757	Crystalstructure of E. coli YgjK D324N complexed with melibiose [Escherichia coli K-12],3W7X_B Crystal structure of E. coli YgjK D324N complexed with melibiose [Escherichia coli K-12],5CA3_A Crystal structure of the glycosynthase mutant D324N of Escherichia coli GH63 glycosidase in complex with glucose and lactose [Escherichia coli K-12],5CA3_B Crystal structure of the glycosynthase mutant D324N of Escherichia coli GH63 glycosidase in complex with glucose and lactose [Escherichia coli K-12]
3W7W_A	9.90e-250	6	755	71	757	Crystalstructure of E. coli YgjK E727A complexed with 2-O-alpha-D-glucopyranosyl-alpha-D-galactopyranose [Escherichia coli K-12],3W7W_B Crystal structure of E. coli YgjK E727A complexed with 2-O-alpha-D-glucopyranosyl-alpha-D-galactopyranose [Escherichia coli K-12],5GW7_A Crystal structure of the glycosynthase mutant E727A of Escherichia coli GH63 glycosidase in complex with glucose and lactose [Escherichia coli K-12],5GW7_B Crystal structure of the glycosynthase mutant E727A of Escherichia coli GH63 glycosidase in complex with glucose and lactose [Escherichia coli K-12]
3D3I_A	1.05e-241	6	755	72	758	Crystalstructural of Escherichia coli K12 YgjK, a glucosidase belonging to glycoside hydrolase family 63 [Escherichia coli K-12],3D3I_B Crystal structural of Escherichia coli K12 YgjK, a glucosidase belonging to glycoside hydrolase family 63 [Escherichia coli K-12]
7PQQ_B	1.93e-122	6	412	397	785	ChainB, Anti-RON nanobody,Megabody 91,Glucosidase YgjK [Lama glama]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P42592	1.46e-249	6	755	94	780	Glucosidase YgjK OS=Escherichia coli (strain K12) OX=83333 GN=ygjK PE=1 SV=1
D8QTR2	7.78e-12	265	745	98	479	Mannosylglycerate hydrolase MGH1 OS=Selaginella moellendorffii OX=88036 GN=MGH PE=1 SV=1
D8T3S4	1.36e-11	265	745	98	479	Mannosylglycerate hydrolase MGH2 OS=Selaginella moellendorffii OX=88036 GN=SELMODRAFT_447962 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000056	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002532_03632.