CAZyme Information: MGYG000002533_00314

Basic Information

• Species: Vibrio vulnificus
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Vibrionaceae; Vibrio; Vibrio vulnificus
• CAZyme ID: MGYG000002533_00314
• CAZy Family: GH103
• CAZyme Description: Tn3 family transposase TnXax1

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
323	MGYG000002533_1|CGC5	36731.65	8.7357

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002533	4933179	Isolate	Bangladesh	Asia

• Gene Location: Start: 318912; End: 319883 Strand: +

Full Sequence      

MKKLVTAILSIGLCSSAWANTESFEQYLERLKAQAAEEGISAQTIEQAFRDVQFKPRAVK
ADRNQPEKKQTLDEYLPRAVPDWKVKQAKDLYAKHYAELSQIADRYGVQARFIVALWGVE
SNFGKFTGNFPVVDALSTMAYEGRREAFFRAETMAALKILDQGHIEFENFKGSWAGAMGQ
CQFMPSSFLAYAADGNGDGKKDIWNTKADVFASTASYLSQSGWDDKYTWGRQVRVPKGFD
LELEGREEAKGKYLQEWKKLGITSINGRPLPKLNEDIKAWLVMPDDENGRAYLVYNNYNV
LMKWNRSHYFALAVSHLADRIKN

Enzyme Prediction     

No EC number prediction in MGYG000002533_00314.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH103	24	322	2.1e-120	0.9966101694915255

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam13406	SLT_2	1.57e-149	23	319	1	292	Transglycosylase SLT domain. This family is related to the SLT domain pfam01464.
TIGR02283	MltB_2	4.56e-138	23	322	1	299	lytic murein transglycosylase. Members of this family are closely related to the MltB family lytic murein transglycosylases described by TIGR02282 and are likewise all proteobacterial, although that family and this one form clearly distinct clades. Several species have one member of each family. Many members of this family (unlike the MltB family) contain an additional C-terminal domain, a putative peptidoglycan binding domain (pfam01471), not included in region described by this model. Many sequences appear to contain N-terminal lipoprotein attachment sites, as does E. coli MltB in TIGR02282. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]
COG2951	MltB	1.71e-131	24	322	41	336	Membrane-bound lytic murein transglycosylase B [Cell wall/membrane/envelope biogenesis].
TIGR02282	MltB	1.23e-55	34	321	7	290	lytic murein transglycosylase B. This family consists of lytic murein transglycosylases (murein hydrolases) in the family of MltB, which is a membrane-bound lipoprotein in Escherichia coli. The N-terminal lipoprotein modification motif is conserved in about half the members of this family. The term Slt35 describes a naturally occurring soluble fragment of MltB. Members of this family never contain the putative peptidoglycan binding domain described by pfam01471, which is associated with several classes of bacterial cell wall lytic enzymes. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]
PRK10760	PRK10760	1.44e-32	81	322	122	354	murein hydrolase B; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QBN13424.1	8.16e-241	1	323	1	323
ANN27204.1	8.16e-241	1	323	1	323
AIL70076.1	8.16e-241	1	323	1	323
BAC93823.1	8.16e-241	1	323	1	323
QBH27763.1	8.16e-241	1	323	1	323

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5ANZ_A	4.51e-80	22	322	46	344	CrystalStructure of SltB3 from Pseudomonas aeruginosa. [Pseudomonas aeruginosa],5AO7_A Crystal Structure of SltB3 from Pseudomonas aeruginosa in complex with NAG-anhNAM-pentapeptide [Pseudomonas aeruginosa]
5AO8_A	4.51e-80	22	322	46	344	CrystalStructure of SltB3 from Pseudomonas aeruginosa in complex with NAG-NAM-pentapeptide [Pseudomonas aeruginosa]
5O8X_A	1.85e-39	26	321	7	299	TheX-ray Structure of Catenated Lytic Transglycosylase SltB1 from Pseudomonas aeruginosa [Pseudomonas aeruginosa],5O8X_B The X-ray Structure of Catenated Lytic Transglycosylase SltB1 from Pseudomonas aeruginosa [Pseudomonas aeruginosa]
4ANR_A	2.73e-39	26	321	24	316	Crystalstructure of soluble lytic Transglycosylase SltB1 from Pseudomonas aeruginosa [Pseudomonas aeruginosa PAO1]
1LTM_A	4.92e-21	106	321	107	314	AcceleratedX-ray Structure Elucidation Of A 36 Kda Muramidase/transglycosylase Using Warp [Escherichia coli]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P41052	4.40e-20	106	321	148	355	Membrane-bound lytic murein transglycosylase B OS=Escherichia coli (strain K12) OX=83333 GN=mltB PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.002137	0.963094	0.033889	0.000322	0.000266	0.000259

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002533_00314.