CAZyme Information: MGYG000002533_01513

Basic Information

• Species: Vibrio vulnificus
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Vibrionaceae; Vibrio; Vibrio vulnificus
• CAZyme ID: MGYG000002533_01513
• CAZy Family: CE2
• CAZyme Description: Acetylxylan esterase / glucomannan deacetylase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
361	MGYG000002533_3|CGC1	40544.49	5.4931

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002533	4933179	Isolate	Bangladesh	Asia

• Gene Location: Start: 144770; End: 145855 Strand: -

Full Sequence      

MFYRLICSLALGLCTASALAQSLPATNHNLTFEGRNSKNYQDGSVAVNWPGSTLKTRFIG
SHFALTMQGNGDYFDVLVDGKLSTTLMTQPNGVTETFVLFASESTQNVLLEVVKRTENYA
SMSRFLSVEHNGSIDGVWGHKPHILFIGDSISAGFGSESEKRECTWEEIYATSNARLAFP
YQTGQQLNTTITQVSFSGLGLIRNWGGNQPHHNLTTYTDKVAAVYGLTLDYEDKFPNLIV
VEVGTNDFSTDPQAHEPWSNIEEVKQAWTERMVEYVSELKHRYHQVPIILMPRPAYPYDY
IIPATQDAIETLAQQEIHQVYSHTFVSPLEGCIWHPTAQEHREIATQLSQFIRQQALLTT
P

Enzyme Prediction     

No EC number prediction in MGYG000002533_01513.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE2	143	352	7.1e-54	0.9952153110047847

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd01831	Endoglucanase_E_like	1.40e-44	143	353	1	169	Endoglucanase E-like members of the SGNH hydrolase family; Endoglucanase E catalyzes the endohydrolysis of 1,4-beta-glucosidic linkages in cellulose, lichenin and cereal beta-D-glucans.
pfam17996	CE2_N	1.63e-11	42	129	10	97	Carbohydrate esterase 2 N-terminal. This is the N-terminal beta-sheet domain with jelly roll topology found in CE2 acetyl-esterase from the bacterium Clostridium thermocellum. This enzyme displays dual activities, it catalyses the deacetylation of plant polysaccharides and also potentiates the activity of its appended cellulase catalytic module through its noncatalytic cellulose binding function. This N-terminal jelly-roll domain appears to extend the substrate/cellulose binding cleft of the catalytic domain in C.thermocellum.
cd00229	SGNH_hydrolase	1.35e-09	144	351	1	187	SGNH_hydrolase, or GDSL_hydrolase, is a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the typical Ser-His-Asp(Glu) triad from other serine hydrolases, but may lack the carboxlic acid.
pfam13472	Lipase_GDSL_2	7.26e-07	146	326	1	145	GDSL-like Lipase/Acylhydrolase family. This family of presumed lipases and related enzymes are similar to pfam00657.
pfam00657	Lipase_GDSL	0.001	144	345	1	221	GDSL-like Lipase/Acylhydrolase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QBH29699.1	4.41e-271	1	361	1	361
ASC59786.1	1.26e-270	1	361	1	361
QNE02981.1	1.26e-270	1	361	1	361
AUJ36767.1	1.26e-270	1	361	1	361
ANN29304.1	7.30e-270	1	361	1	361

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2W9X_A	2.30e-29	11	354	7	355	Theactive site of a carbohydrate esterase displays divergent catalytic and non-catalytic binding functions [Cellvibrio japonicus],2W9X_B The active site of a carbohydrate esterase displays divergent catalytic and non-catalytic binding functions [Cellvibrio japonicus]
2WAO_A	1.17e-16	27	250	8	228	ChainA, ENDOGLUCANASE E [Acetivibrio thermocellus]
2WAB_A	2.90e-16	27	250	8	228	ChainA, ENDOGLUCANASE E [Acetivibrio thermocellus]
2WAA_A	4.13e-16	22	354	12	335	Structureof a family two carbohydrate esterase from Cellvibrio japonicus [Cellvibrio japonicus]
3U37_A	4.18e-08	125	250	149	281	AnAcetyl Xylan Esterase (Est2A) from the Rumen Bacterium Butyrivibrio proteoclasticus. [Butyrivibrio proteoclasticus B316],3U37_B An Acetyl Xylan Esterase (Est2A) from the Rumen Bacterium Butyrivibrio proteoclasticus. [Butyrivibrio proteoclasticus B316],3U37_C An Acetyl Xylan Esterase (Est2A) from the Rumen Bacterium Butyrivibrio proteoclasticus. [Butyrivibrio proteoclasticus B316],3U37_D An Acetyl Xylan Esterase (Est2A) from the Rumen Bacterium Butyrivibrio proteoclasticus. [Butyrivibrio proteoclasticus B316],3U37_E An Acetyl Xylan Esterase (Est2A) from the Rumen Bacterium Butyrivibrio proteoclasticus. [Butyrivibrio proteoclasticus B316],3U37_F An Acetyl Xylan Esterase (Est2A) from the Rumen Bacterium Butyrivibrio proteoclasticus. [Butyrivibrio proteoclasticus B316],3U37_G An Acetyl Xylan Esterase (Est2A) from the Rumen Bacterium Butyrivibrio proteoclasticus. [Butyrivibrio proteoclasticus B316],3U37_H An Acetyl Xylan Esterase (Est2A) from the Rumen Bacterium Butyrivibrio proteoclasticus. [Butyrivibrio proteoclasticus B316]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
B3PDE5	1.14e-28	11	354	7	355	Acetylxylan esterase / glucomannan deacetylase OS=Cellvibrio japonicus (strain Ueda107) OX=498211 GN=ce2C PE=1 SV=1
P10477	1.46e-15	20	250	482	709	Cellulase/esterase CelE OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=celE PE=1 SV=2
B3PIB0	2.47e-15	22	354	31	354	Acetylxylan esterase / glucomannan deacetylase OS=Cellvibrio japonicus (strain Ueda107) OX=498211 GN=axe2C PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000428	0.998492	0.000304	0.000267	0.000251	0.000229

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002533_01513.