CAZyme Information: MGYG000002533_02425

Basic Information

• Species: Vibrio vulnificus
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Vibrionaceae; Vibrio; Vibrio vulnificus
• CAZyme ID: MGYG000002533_02425
• CAZy Family: AA10
• CAZyme Description: GlcNAc-binding protein A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
485	MGYG000002533_5|CGC1	52920.08	4.4784

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002533	4933179	Isolate	Bangladesh	Asia

• Gene Location: Start: 38327; End: 39784 Strand: +

Full Sequence      

MKKQPQKTLLAIALSVVSGTAMSHGYVSAVENGVAEARVTLCKFAASTGEKNTNCGAIQY
EPQSVEGPDGFPASGPRDGKIASAESALANALDEQTADRWVKRPIQAGAQNFEWTFTANH
VTKDWKYYITKPDWNPNQPLARASFDLTPFCVVDGGMVQPPKRVSHTCNVPEREGYQVIL
AVWDVGDTAASFYNVIDVKFDGDGPALPDWQQGGQIIPTMNLNVGDTVFTRVFDLAGENP
SYTTELAIDSDALTVANNWSHALAVKINQTQSEIAAGQLNEQNQFVPVYGTNPIFLKSGS
NLQRVEIGYKIETPAPEYDVTLSGLASEYQISDVPVTLDLSLQATGDITTELTVYNHHKE
PLAFESVAMKDGENKAVSMTLSKSEADHHMLVTKVLDKDGTLQKQQTSDFMLTETQTPPP
SDDYDFVFPDGLSSYTAGTKVLASDGAIYQCKPFPYSGYCVQWTPTATQYQPGTGSHWQM
AWDKL

Enzyme Prediction     

No EC number prediction in MGYG000002533_02425.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA10	24	198	2.9e-50	0.9887640449438202
CBM73	433	483	1.2e-18	0.8703703703703703

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK13211	PRK13211	0.0	1	485	1	477	N-acetylglucosamine-binding protein GbpA.
COG3397	COG3397	1.33e-122	1	302	1	308	Predicted carbohydrate-binding protein, contains CBM5 and CBM33 domains [General function prediction only].
cd21177	LPMO_AA10	8.96e-71	24	198	1	179	lytic polysaccharide monooxygenase (LPMO) auxiliary activity family 10 (AA10). AA10 proteins are copper-dependent lytic polysaccharide monooxygenases (LPMOs), which may act on chitin or cellulose. The family used to be called CBM33. Activities in this family include lytic cellulose monooxygenase (C1-hydroxylating) (EC 1.14.99.54), lytic cellulose monooxygenase (C4-dehydrogenating) (EC 1.14.99.56), lytic chitin monooxygenase (EC 1.14.99.53), and lytic xylan monooxygenase/xylan oxidase (glycosidic bond-cleaving) (EC 1.14.99.-). Also included are viral chitin-binding glycoproteins such as fusolin and spheroidin-like proteins.
pfam03067	LPMO_10	1.03e-56	24	198	1	186	Lytic polysaccharide mono-oxygenase, cellulose-degrading. This domain is found associated with a wide variety of cellulose binding domains. This is a family of two very closely related proteins that together act as both a C1- and a C4-oxidising lytic polysaccharide mono-oxygenase, degrading cellulose. This domain is also found in baculoviral spheroidins and spindolins, protein of unknown function.
pfam18416	GbpA_2	1.37e-32	210	308	1	102	N-acetylglucosamine binding protein domain 2. This domain can be found in N-acetylglucosamine binding protein (GbpA) from Vibrio cholerae, a bacterial pathogen that colonizes the chitinous exoskeleton of zooplankton as well as the human gastrointestinal tract. GbpA binds to GlcNAc oligosaccharides. Structural comparison show that there are distant structural similarities between domain 2 of GbpA and the beta-domain of the flagellin protein p5. It is suggested that this domain interacts with the bacterial surface, and functions to project an alginate binding domain of the protein from the cell surface.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AIL72615.1	0.0	1	485	1	485
AUJ37341.1	0.0	1	485	1	485
ALM72947.1	0.0	1	485	1	485
ANH65307.1	0.0	1	485	1	485
ARN67953.1	0.0	1	485	1	485

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2XWX_A	1.50e-222	24	414	1	391	Vibriocholerae colonization factor GbpA crystal structure [Vibrio cholerae],2XWX_B Vibrio cholerae colonization factor GbpA crystal structure [Vibrio cholerae]
2BEM_A	4.39e-55	24	199	1	167	Crystalstructure of the Serratia marcescens chitin-binding protein CBP21 [Serratia marcescens],2BEM_B Crystal structure of the Serratia marcescens chitin-binding protein CBP21 [Serratia marcescens],2BEM_C Crystal structure of the Serratia marcescens chitin-binding protein CBP21 [Serratia marcescens],2LHS_A Structure of the chitin binding protein 21 (CBP21) [Serratia marcescens]
2BEN_A	9.32e-54	24	199	1	167	Crystalstructure of the Serratia marcescens chitin-binding protein CBP21 Y54A mutant. [Serratia marcescens],2BEN_B Crystal structure of the Serratia marcescens chitin-binding protein CBP21 Y54A mutant. [Serratia marcescens]
5WSZ_A	7.40e-52	24	199	1	165	Crystalstructure of a lytic polysaccharide monooxygenase,BtLPMO10A, from Bacillus thuringiensis [Bacillus thuringiensis serovar kurstaki],5WSZ_B Crystal structure of a lytic polysaccharide monooxygenase,BtLPMO10A, from Bacillus thuringiensis [Bacillus thuringiensis serovar kurstaki],5WSZ_C Crystal structure of a lytic polysaccharide monooxygenase,BtLPMO10A, from Bacillus thuringiensis [Bacillus thuringiensis serovar kurstaki],5WSZ_D Crystal structure of a lytic polysaccharide monooxygenase,BtLPMO10A, from Bacillus thuringiensis [Bacillus thuringiensis serovar kurstaki]
6T5Z_A	1.55e-47	24	197	1	168	Crystalstructure of an AA10 LPMO from Photorhabdus luminescens [Photorhabdus laumondii subsp. laumondii TTO1],6T5Z_B Crystal structure of an AA10 LPMO from Photorhabdus luminescens [Photorhabdus laumondii subsp. laumondii TTO1],6T5Z_C Crystal structure of an AA10 LPMO from Photorhabdus luminescens [Photorhabdus laumondii subsp. laumondii TTO1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8D7V4	0.0	1	485	1	485	GlcNAc-binding protein A OS=Vibrio vulnificus (strain CMCP6) OX=216895 GN=gbpA PE=3 SV=1
Q7MEW9	0.0	1	485	1	485	GlcNAc-binding protein A OS=Vibrio vulnificus (strain YJ016) OX=196600 GN=gbpA PE=3 SV=1
A5F0H4	5.97e-280	1	484	1	484	GlcNAc-binding protein A OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) OX=345073 GN=gbpA PE=3 SV=1
Q9KLD5	1.20e-279	1	484	1	484	GlcNAc-binding protein A OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) OX=243277 GN=gbpA PE=1 SV=1
C3LW75	1.71e-279	1	484	1	484	GlcNAc-binding protein A OS=Vibrio cholerae serotype O1 (strain M66-2) OX=579112 GN=gbpA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000285	0.999043	0.000189	0.000180	0.000146	0.000136

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002533_02425.