CAZyme Information: MGYG000002533_02663

Basic Information

• Species: Vibrio vulnificus
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Vibrionaceae; Vibrio; Vibrio vulnificus
• CAZyme ID: MGYG000002533_02663
• CAZy Family: CBM50
• CAZyme Description: putative L,D-transpeptidase YcfS

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
305	MGYG000002533_5|CGC6	33796.1	5.7371

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002533	4933179	Isolate	Bangladesh	Asia

• Gene Location: Start: 298983; End: 299900 Strand: -

Full Sequence      

MKMPKPTLITLFCAALMSWKSDAATYDLPAEGSRLIGRIQHHVVEKGETMANIAKQYDVG
FLALMAANKGVDPFLPQEGYVLSIPSEMVLPPVEYQGIVINLAELRLYYFEPELGKVHVF
PVGIGRVGRDTPEMVTSIREKRPNPTWTPPASIRKEYREKGIELPKIVPAGPDNPLGEYA
LRLAYGSGDYLIHGTNKDFGIGLRVSAGCIRMEPKDIEWLFSQVDKGQRVKIINQPVKVS
LEPGRIVYLEAHEPLTRSNGVQDELVVPIELDWWLSELNLNDSKAKAVIAAQNGVPVEVA
APGFE

Enzyme Prediction     

No EC number prediction in MGYG000002533_02663.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK10260	PRK10260	3.98e-93	1	299	1	305	L,D-transpeptidase; Provisional
PRK10190	PRK10190	2.04e-86	3	303	1	306	L,D-transpeptidase; Provisional
COG1376	ErfK	4.08e-46	23	236	23	232	Lipoprotein-anchoring transpeptidase ErfK/SrfK [Cell wall/membrane/envelope biogenesis].
cd16913	YkuD_like	3.44e-40	98	233	2	121	L,D-transpeptidases/carboxypeptidases similar to Bacillus YkuD. Members of the YkuD-like family of proteins are found in a range of bacteria. The best studied member Bacillus YkuD has been shown to act as an L,D-transpeptidase that gives rise to an alternative pathway for peptidoglycan cross-linking. Another member Helicobacter pylori Csd6 functions as an L,D-carboxypeptidase and regulates helical cell shape and motility. The conserved region contains a conserved histidine and cysteine, with the cysteine thought to be an active site residue.
pfam17969	Ldt_C	5.50e-21	236	299	1	67	L,D-transpeptidase C-terminal domain. This is the C-terminal domain found in d-transpeptidases (Ldt) homologues from E.coli. Three of these enzymes (YbiS, ErfK, YcfS) have been shown to cross-link Braun's lipoprotein to the peptidoglycan (PG), while the other two (YnhG, YcbB) form direct meso-diaminopimelate (DAP-DAP, or 3-3) cross-links within the PG. Family members include erfK (ldtA), ybiS (ldtB), ycfS (ldtC), and ynhG (ldtE).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUY00823.1	8.41e-161	13	305	10	302
QPC55488.1	8.41e-161	13	305	10	302
QTV10206.1	8.41e-161	13	305	10	302
QLK92159.1	8.41e-161	13	305	10	302
QTV04013.1	8.41e-161	13	305	10	302

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4LZH_A	2.45e-70	21	299	1	284	ChainA, L,D-transpeptidase [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P75954	1.87e-91	7	299	12	310	Probable L,D-transpeptidase YcfS OS=Escherichia coli (strain K12) OX=83333 GN=ycfS PE=1 SV=1
P76193	7.57e-81	7	256	10	256	Probable L,D-transpeptidase YnhG OS=Escherichia coli (strain K12) OX=83333 GN=ynhG PE=1 SV=1
P39176	4.25e-77	3	299	1	302	Probable L,D-transpeptidase ErfK/SrfK OS=Escherichia coli (strain K12) OX=83333 GN=erfK PE=1 SV=2
P40680	1.06e-74	12	304	10	309	Probable L,D-transpeptidase ErfK/SrfK OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=erfK PE=3 SV=1
P0AAX8	1.37e-74	10	271	7	273	Probable L,D-transpeptidase YbiS OS=Escherichia coli (strain K12) OX=83333 GN=ybiS PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000289	0.998901	0.000283	0.000167	0.000166	0.000153

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002533_02663.