CAZyme Information: MGYG000002533_03033

Basic Information

• Species: Vibrio vulnificus
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Vibrionaceae; Vibrio; Vibrio vulnificus
• CAZyme ID: MGYG000002533_03033
• CAZy Family: CBM69
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
162	MGYG000002533_7|CGC3	17929.67	8.2645

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002533	4933179	Isolate	Bangladesh	Asia

• Gene Location: Start: 82089; End: 82577 Strand: +

Full Sequence      

MKRTFLIAVVTATVLASCASTSPEQAAPELTNVDARFSDCRLPTLESDRGPIKPSLFVVG
TFPDGQWIHMDNRKMGYKGDGIYQVVSEEKAGNVSLQFATMSWTPQFTVSGMEMAVGQLK
ELKRGGFAKNTVVHLPKDAKYLWTIQLSPDKKPQWAMVTECQ

Enzyme Prediction     

No EC number prediction in MGYG000002533_03033.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CBM69	36	161	7.1e-47	0.9612403100775194

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd02861	E_set_pullulanase_like	0.002	55	126	12	82	Early set domain associated with the catalytic domain of pullulanase-like proteins. E or "early" set domains are associated with the catalytic domain of pullulanase at either the N-terminal or C-terminal end, and in a few instances at both ends. Pullulanase (also called dextrinase or alpha-dextrin endo-1,6-alpha glucosidase) is an enzyme with action similar to that of isoamylase; it cleaves 1,6-alpha-glucosidic linkages in pullulan, amylopectin, and glycogen, and in alpha-and beta-amylase limit-dextrins of amylopectin and glycogen. The E set domain of pullulanase may be related to the immunoglobulin and/or fibronectin type III superfamilies. These domains are associated with different types of catalytic domains at either the N-terminal or C-terminal end and may be involved in homodimeric/tetrameric/dodecameric interactions. Members of this family include members of the alpha amylase family, sialidase, galactose oxidase, cellulase, cellulose, hyaluronate lyase, chitobiase, and chitinase. This domain is also a member of the CBM48 (Carbohydrate Binding Module 48) family whose members include maltooligosyl trehalose synthase, starch branching enzyme, glycogen branching enzyme, glycogen debranching enzyme, isoamylase, and the beta subunit of AMP-activated protein kinase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ANH64857.1	4.44e-115	1	162	1	162
ALM72495.1	4.44e-115	1	162	1	162
QNE02616.1	4.44e-115	1	162	1	162
ASM98138.1	4.99e-112	1	162	1	162
QET74778.1	4.99e-112	1	162	1	162

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5X5S_A	1.38e-31	37	161	25	148	Ligandinduced structure of AmyP-SBD [uncultured bacterium]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000000	1.000081	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002533_03033.